Basic Vector Information
- Vector Name:
- pCN55
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5730 bp
- Type:
- Staphylococcal shuttle vector
- Replication origin:
- ori
- Source/Author:
- Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH.
pCN55 vector Map
pCN55 vector Sequence
LOCUS V008332 5730 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008332 VERSION V008332 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5730) AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH. TITLE Sequencing of a set of cassette-based shuttle vectors for Gram-positive bacteria deposited at BEI resources from the NARSA collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5730) AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH. TITLE Direct Submission JOURNAL Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, USA REFERENCE 3 (bases 1 to 5730) TITLE Direct Submission REFERENCE 4 (bases 1 to 5730) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7.0.2 Coverage :: 52846 Sequencing Technology :: Illumina ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5730 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..2089 /note="pT181copwt repC; Staphylococcus replication cassette; derived from J04764" misc_feature 159..392 /label="RS-B site" /note="RS-B site" rep_origin 656..823 /note="ori; derived from Staphylococcus aureus" CDS 688..1632 /codon_start=1 /product="RepC" /label="RepC" /note="polypeptide A" /protein_id="AMR43712.1" /translation="MYKNNHANHSNHLENHDLDNFSKTGYSNSRLDAHTVCISDPKLSF DAMTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWD RRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVK KTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHLWRVEIELKRDMV DYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISP VDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK" variation 1132..1134 /label="E149D" /note="E149D" misc_feature 1794..2089 /label="truncated polypeptide B" /note="truncated polypeptide B" regulatory 2246..2251 /regulatory_class="minus_35_signal" regulatory 2269..2274 /regulatory_class="minus_10_signal" regulatory 2423..2428 /regulatory_class="ribosome_binding_site" CDS 2434..3213 /gene="ant1" /label="Spectinomycin 9-adenylyltransferase" /note="Spectinomycin 9-adenylyltransferase from Staphylococcus aureus (strain N315). Accession#: P0A0D1" regulatory 3292..3338 /regulatory_class="terminator" repeat_region 3292..3309 /label="inverted repeat" /note="inverted repeat" repeat_region 3319..3338 /label="inverted repeat" /note="inverted repeat" promoter 3666..3770 /label="AmpR promoter" CDS 3771..4628 /label="AmpR" /note="beta-lactamase" rep_origin 4802..5390 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 5527..5571 /note="polylinker; derived from M13mp19" primer_bind complement(5572..5588) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants"
This page is informational only.