Basic Vector Information
- Vector Name:
- pCV2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4893 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- VanDrisse CM, Escalante-Semerena JC.
- Promoter:
- araBAD
pCV2 vector Map
pCV2 vector Sequence
LOCUS 40924_13845 4893 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCV2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4893) AUTHORS VanDrisse CM, Escalante-Semerena JC. TITLE New high-cloning-efficiency vectors for complementation studies and recombinant protein overproduction in Escherichia coli and Salmonella enterica JOURNAL Plasmid (2016) In press PUBMED 27234933 REFERENCE 2 (bases 1 to 4893) AUTHORS VanDrisse CM, Escalante-Semerena JC. TITLE Direct Submission JOURNAL Submitted (24-MAR-2016) Microbiology, University of Georgia, 120 Cedar St., Athens, GA 30602, USA REFERENCE 3 (bases 1 to 4893) TITLE Direct Submission REFERENCE 4 (bases 1 to 4893) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid (2016) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-MAR-2016) Microbiology, University of Georgia, 120 Cedar St., Athens, GA 30602, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4893 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 240..326 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 418..445 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 464..555 /label=AmpR promoter CDS 556..1413 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 1458..1913 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin complement(2874..3419) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(3693..4568) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 4595..4879 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)"
This page is informational only.