Basic Vector Information
- Vector Name:
- pCST5-del-URA3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6271 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Cote P, Sulea T, Dignard D, Wu C, Whiteway M.
- Promoter:
- lac
pCST5-del-URA3 vector Map
pCST5-del-URA3 vector Sequence
LOCUS V008131 6271 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008131 VERSION V008131 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6271) AUTHORS Cote P, Sulea T, Dignard D, Wu C, Whiteway M. TITLE Evolutionary reshaping of fungal mating pathway scaffold proteins JOURNAL MBio 2 (1), e00230-10 (2011) PUBMED 21249169 REFERENCE 2 (bases 1 to 6271) AUTHORS Cote P. TITLE Direct Submission JOURNAL Submitted (02-NOV-2010) Health Sector, CNRC-BRI, 6100 Royalmount Av., Montreal, QC H4P2R2, Canada REFERENCE 3 (bases 1 to 6271) TITLE Direct Submission REFERENCE 4 (bases 1 to 6271) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "MBio"; date: "2011"; volume: "2"; issue: "1"; pages: "e00230-10" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-NOV-2010) Health Sector, CNRC-BRI, 6100 Royalmount Av., Montreal, QC H4P2R2, Canada" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6271 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 411..1204 /codon_start=1 /product="Cst5" /label="Cst5" /note="5' end disruption cassette" /protein_id="ADW40659.1" /translation="MLQSTPKSWKDFLKSPKKPTSPTTPPGSVTITPNTTPPSVPCVSP RPAKIPSRDPFQTINPGLNLSFANILNKSLANHETCFICGELLSTVFASERILKLNCGD STHSECFKAYFKEDIPHARIHGKTITFAKTCRGLNCSGTRNVVVDVNNWHLVSARKLSL IPKRPAPPHPNSVNINALKTTLQNSDIPTRSPSPDPTVSTTTEVDAYEVETVRNQLIKY LLDLCPKINLSRLVLLGNLRVADELSVCVEPLDYFQTRYVYL" primer_bind complement(1249..1265) /label="SK primer" /note="common sequencing primer, one of multiple similar variants" CDS complement(1269..2078) /gene="URA3" /label="Orotidine 5'-phosphate decarboxylase" /note="Orotidine 5'-phosphate decarboxylase from Candida albicans (strain SC5314 / ATCC MYA-2876). Accession#: P13649" promoter complement(2915..2933) /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(2954..2970) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind 2978..2994 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3002..3032) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 3047..3068 /label="CAP binding site" /bound_moiety="E. coli catabolite activator protein" /note="CAP binding activates transcription in the presence of cAMP." CDS 3078..3435 /codon_start=1 /product="Cst5" /label="Cst5" /note="3' end disruption cassette" /protein_id="ADW40660.1" /translation="RKLHGYME*C*LPCIRPYAEYPNLLSWIVHPTSASKR*WVIDIDS IYI*HSSGKMGCCHF*RSFTVASTGYNVYN*HLP****FRY*FRRRSYSASTN*KQLGR FND*D**CVTYI*PV" primer_bind complement(4033..4049) /label="SK primer" /note="common sequencing primer, one of multiple similar variants" promoter complement(4086..4104) /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(4125..4141) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4149..4165) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4173..4203) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(4218..4239) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4527..5115) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5289..6146) /label="AmpR" /note="beta-lactamase" promoter complement(6147..6251) /label="AmpR promoter"
This page is informational only.