pBBRKW2HTsLsM vector (V009251)

Download GeneBank File(.gb)

LOCUS       V009251                 8603 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V009251
VERSION     V009251
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8603)
  AUTHORS   Faries KM, Kressel LL, Wander MJ, Holten D, Laible PD, Kirmaier C,
            Hanson DK.
  TITLE     High throughput engineering to revitalize a vestigial electron
            transfer pathway in bacterial photosynthetic reaction centers
  JOURNAL   J. Biol. Chem. 287 (11), 8507-8514 (2012)
   PUBMED   22247556
REFERENCE   2  (bases 1 to 8603)
  AUTHORS   Kressel L, Wander MJ, Hanson DK, Laible PD.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-AUG-2011) Biosciences, Argonne National Laboratory,
            9700 S. Cass Ave., Argonne, IL 60439, USA
REFERENCE   3  (bases 1 to 8603)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8603)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. Biol.
            Chem."; date: "2012"; volume: "287"; issue: "11"; pages: "8507-8514"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (08-AUG-2011) Biosciences, Argonne National Laboratory, 9700 S. Cass
            Ave., Argonne, IL 60439, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8603
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      1023..1792
                     /label="pBBR1 oriV"
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1
                     Rep protein for replication"
     CDS             1793..2452
                     /label="pBBR1 Rep"
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"
     primer_bind     3162..3178
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        3188..3206
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             complement(4132..4368)
                     /codon_start=1
                     /gene="pufX"
                     /product="intrinsic membrane protein PufX"
                     /label="pufX"
                     /protein_id="AEW50176.1"
                     /translation="MSMFDKPFDYENGSKFEMGIWIGRQMAYGAFLGSIPFLLGLGLVL
                     GSYGLGLMLPERAHQAPSPYTTEVVVQHATEVV"
     gene            complement(4132..4368)
                     /gene="pufX"
                     /label="pufX"
     CDS             complement(4384..4404)
                     /label="7xHis"
                     /note="6xHis affinity tag"
     CDS             complement(4405..5325)
                     /gene="pufM"
                     /label="Reaction center protein M chain"
                     /note="Reaction center protein M chain from Rhodobacter
                     capsulatus. Accession#: P11847"
     CDS             complement(5321..6166)
                     /gene="pufL"
                     /label="Reaction center protein L chain"
                     /note="Reaction center protein L chain from Rhodobacter
                     capsulatus. Accession#: P19057"
     CDS             complement(6302..6475)
                     /gene="pufA"
                     /label="Light-harvesting protein B-870 alpha chain"
                     /note="Light-harvesting protein B-870 alpha chain from
                     Rhodobacter capsulatus. Accession#: P02948"
     CDS             complement(6492..6638)
                     /gene="pufB"
                     /label="Light-harvesting protein B-870 beta chain"
                     /note="Light-harvesting protein B-870 beta chain from
                     Rhodobacter capsulatus. Accession#: P02950"
     promoter        complement(6802..6820)
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(6841..6857)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(6865..6881)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6889..6919)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(6934..6955)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     CDS             complement(7359..8150)
                     /label="NeoR/KanR"
                     /note="aminoglycoside phosphotransferase"