Basic Vector Information
- Vector Name:
- pBAKA
- Length:
- 4488 bp
- Type:
- Gene replacement vector
- Replication origin:
- ori
- Source/Author:
- Barrett AR, Kang Y, Inamasu KS, Son MS, Vukovich JM, Hoang TT.
pBAKA vector Map
pBAKA vector Sequence
LOCUS V009286 4488 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009286 VERSION V009286 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4488) AUTHORS Barrett AR, Kang Y, Inamasu KS, Son MS, Vukovich JM, Hoang TT. TITLE Genetic tools for allelic replacement in Burkholderia species JOURNAL Appl. Environ. Microbiol. 74 (14), 4498-4508 (2008) PUBMED 18502918 REFERENCE 2 (bases 1 to 4488) AUTHORS Barrett AR, Kang Y, Son MS, Vukovich JM, Hoang TT. TITLE Direct Submission JOURNAL Submitted (05-NOV-2007) Microbiology, University of Hawaii Manoa, 2538 McCarthy Mall Snyder Hall, Rm. 310, Honolulu, HI 96822, USA REFERENCE 3 (bases 1 to 4488) TITLE Direct Submission REFERENCE 4 (bases 1 to 4488) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2008"; volume: "74"; issue: "14"; pages: "4498-4508" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-NOV-2007) Microbiology, University of Hawaii Manoa, 2538 McCarthy Mall Snyder Hall, Rm. 310, Honolulu, HI 96822, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4488 /mol_type="other DNA" /organism="synthetic DNA construct" oriT complement(20..129) /direction=LEFT /label="oriT" /note="incP origin of transfer" terminator complement(550..577) /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(669..755) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 1105..1121 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" misc_feature complement(1125..1181) /label="MCS" /note="pUC18/19 multiple cloning site" primer_bind complement(1191..1207) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1215..1231) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1239..1269) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(1284..1305) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1593..2181) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2266..3381) /codon_start=1 /gene="asd" /product="aspartate semialdehyde dehydrogenase" /label="asd" /note="Asd" /protein_id="ABY75257.1" /translation="MKRVGLIGWRGMVGSVLIQRMLEERDFDLIEPVFFTTSNVGAQAP EVDKDIAPLKDAYSIDELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRME DDAVIVLDPVNRKVIDQALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQA ASGAGAQNMRDLLKQMGAAHASVADDLANPASAILDIDRKVAETLRSEAFPTEHFGAPL GGSLIPWIDKELSQRRQSREEWKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALT IKLNKDVPLTDIEGLIRQHNPWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMV SQYLGAFTVGDQLLWGAAEPLRRMLRILLER" gene complement(2266..3381) /gene="asd" /label="asd" CDS complement(3398..4408) /gene="pheS" /label="Phenylalanine--tRNA ligase alpha subunit" /note="Phenylalanine--tRNA ligase alpha subunit from Burkholderia pseudomallei (strain 1710b). Accession#: Q3JT08" regulatory complement(4444..4486) /regulatory_class="promoter"
This page is informational only.