Basic Vector Information
- Vector Name:
- pAM3G
- Length:
- 3323 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kang Y, Norris MH, Hoang TT.
- Promoter:
- lac
pAM3G vector Vector Map
pAM3G vector Sequence
LOCUS 40924_4384 3323 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pAM3G, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3323) AUTHORS Kang Y, Norris MH, Hoang TT. TITLE Knock-out and pull-out recombineering protocols for natural transformable Burkholderia thailandensis and Burkholderia pseudomallei JOURNAL Unpublished REFERENCE 2 (bases 1 to 3323) AUTHORS Kang Y, Norris MH, Hoang TT. TITLE Direct Submission JOURNAL Submitted (09-OCT-2009) Molecular Biosciences and Biological Engineering, University of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207, Honolulu, HI 96822, USA REFERENCE 3 (bases 1 to 3323) TITLE Direct Submission REFERENCE 4 (bases 1 to 3323) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-OCT-2009) Molecular Biosciences and Biological Engineering, University of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207, Honolulu, HI 96822, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3323 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(12..363) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 377..1207 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" primer_bind 1371..1387 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 1388..1444 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(1457..1473) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1481..1497) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1505..1535) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1550..1571) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." oriT 1955..2063 /label=oriT /note="incP origin of transfer" rep_origin complement(2131..2719) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2803..3243) /codon_start=1 /gene="gat" /product="glyphosate acetyl transferase" /label=gat /note="confers resistance to glyphosate" /protein_id="ADO63834.1" /translation="MIEVKPINAEDTYDLRHRVLRPNQPIEACMFESDLTRSAFHLGGF YGGKLISVASFHQAEHSELQGKKQYQLRGVATLEGYREQKAGSSLVKHAEEILRKRGAD MIWCNARTSASGYYRKLGFSEQGEVFDTPPVGPHILMYKRIT" gene complement(2803..3243) /gene="gat" /label=gat regulatory 3282..3323 /note="PCS12; rpsL promoter from Burkholderia cenocepacia" /regulatory_class="promoter"
This page is informational only.