Basic Vector Information
- Vector Name:
- pAM2770
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8384 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Lee MH, Scherer M, Rigali S, Golden JW.
pAM2770 vector Map
pAM2770 vector Sequence
LOCUS 40924_4379 8384 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pAM2770, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8384) AUTHORS Lee MH, Scherer M, Rigali S, Golden JW. TITLE PlmA, a member of the GntR family, has plasmid maintenance functions in Anabaena sp. strain PCC 7120 JOURNAL Unpublished REFERENCE 2 (bases 1 to 8384) AUTHORS Lee MH. TITLE Direct Submission JOURNAL Submitted (27-MAR-2003) Biology, Texas A REFERENCE 3 (bases 1 to 8384) TITLE Direct Submission REFERENCE 4 (bases 1 to 8384) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-MAR-2003) Biology, Texas A" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8384 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 739..1530 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" misc_feature 2086..2228 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(2414..3002) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3103..3120) /label=6xHis /note="6xHis affinity tag" primer_bind 3377..3393 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(3397..3453) /label=MCS /note="pUC18/19 multiple cloning site" regulatory complement(3467..3841) /label=copper-inducible petE promoter /note="copper-inducible petE promoter" /regulatory_class="promoter" CDS 5291..6412 /codon_start=1 /gene="repA" /product="RepA" /label=repA /note="required for replication" /protein_id="AAO92601.1" /translation="MISPESLNTNVSLTLLTRELQTEIILGTYTVRVHTRIGREPCARL WYLCRALDKDGSGHLTLPLPVVQTFLDCSDKSVYRWLQDGKKIGAFRRYKIKAGMITVY LGGMFQVCYNLNLKRWGDVAVVPLVQVLSDLRSLTTGIVTQSFQQKSRYAANRQLKPEY RKLFGAPHPNELVKDTRQSSLKSPEGEVPCVLHISSSRIFVSKSFIHYGTSQKAVSCEL GIHKRTVRRHQKQLGMNRRQLCQAKIEYNQLRHARNNDASEFWAFTGTKTDIGYQVMGD AVVFSDGIAPGAKKRQPNTYQIDATEFDGRLFKVGDKVFMNRCNIYREQFTLTTMSAAR RKYHFKLSQCHFSENRAGRVGNRFVIGCHSGEI" gene 5291..6412 /gene="repA" /label=repA CDS complement(7033..7584) /codon_start=1 /gene="int/res" /product="integrase/resolvase" /label=int/res /protein_id="AAO92602.1" /translation="MKVNGNGRAKILTSDELRRLFSDGFTTPRDRVLFGICLFTGCRVS EALALQTTDIKGETLTFRKSTTKGKLKTRVVDIQPGLAALMADYHPKPGTLFPGMRGVS DRLTRYAADKILRDAAKRIGLEGISTHSFRRTALNQMSSAGIPLRHIQEISGHNDLGTL QRYLEVTPEQRRKAVSVIGF" gene complement(7033..7584) /gene="int/res" /label=int/res
This page is informational only.