Basic Vector Information
- Vector Name:
- pCB301
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3574 bp
- Type:
- Binary vector
- Replication origin:
- oriV
- Source/Author:
- Xiang C, Han P, Lutziger I, Wang K, Oliver DJ.
pCB301 vector Map
pCB301 vector Sequence
LOCUS 40924_9116 3574 bp DNA circular SYN 17-DEC-2018 DEFINITION Binary vector pCB301, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3574) AUTHORS Xiang C, Han P, Lutziger I, Wang K, Oliver DJ. TITLE A mini binary vector series for plant transformation JOURNAL Plant Mol. Biol. 40 (4), 711-717 (1999) PUBMED 10480394 REFERENCE 2 (bases 1 to 3574) AUTHORS Xiang C, Han P, Lutziger I, Wang K, Oliver DJ. TITLE Direct Submission JOURNAL Submitted (29-MAR-1999) Botany, Iowa State University, Bessey Hall, Ames, IA 50011, USA REFERENCE 3 (bases 1 to 3574) TITLE Direct Submission REFERENCE 4 (bases 1 to 3574) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Mol. Biol."; date: "1999"; volume: "40"; issue: "4"; pages: "711-717" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-MAR-1999) Botany, Iowa State University, Bessey Hall, Ames, IA 50011, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3574 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 12..622 /label=oriV /note="origin of replication for the bacterial F plasmid" CDS 842..1633 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" CDS 1935..3080 /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" misc_feature complement(3235..3259) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" misc_feature 3300..3407 /label=MCS /note="pBluescript multiple cloning site" misc_feature complement(3471..3495) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" rep_origin 3573..3574 /label=oriV /note="incP origin of replication"
This page is informational only.