pCAGGS-T7 vector (V008802)

Price Information

Cat No. Plasmid Name Availability Add to cart
V008802 pCAGGS-T7 In stock, instant shipping

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pCAGGS-T7
Antibiotic Resistance:
Ampicillin
Length:
7421 bp
Type:
Expression vector
Replication origin:
ori
Source/Author:
Paterson RG, Russell CJ, Lamb RA.
Promoter:
CAG

pCAGGS-T7 vector Map

pCAGGS-T77421 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300660069007200CMV enhancerchicken beta-actin promoterchimeric intronT7 RNA polymerasebeta-globin poly(A) signalM13 revlac operatorlac promoterCAP binding siteSV40 promoterSV40 poly(A) signaloriAmpRAmpR promoterCAG

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Jiang Y, Liu H, Liu P, Kong X. Plasmids driven minigenome rescue system for Newcastle disease virus V4 strain. Mol Biol Rep. 2009 Sep;36(7):1909-14. doi: 10.1007/s11033-008-9398-x. Epub 2008 Nov 15. PMID: 19011992.

pCAGGS-T7 vector Sequence

LOCUS       Exported                7421 bp DNA     circular SYN 02-SEP-2024
DEFINITION  Exported.
ACCESSION   V008802
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7421)
  AUTHORS   Paterson RG, Russell CJ, Lamb RA.
  TITLE     Fusion protein of the paramyxovirus SV5: destabilizing and 
            stabilizing mutants of fusion activation
  JOURNAL   Virology 270 (1), 17-30 (2000)
  PUBMED    10772976
REFERENCE   2  (bases 1 to 7421)
  AUTHORS   Wickersham IR, Sullivan HA, Seung HS.
  TITLE     Production of glycoprotein-deleted rabies viruses for monosynaptic 
            tracing and high-level gene expression in neurons
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7421)
  AUTHORS   Wickersham IR.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-DEC-2009) Brain and Cognitive Sciences, Howard Hughes 
            Medical Institute and Massachusetts Institute of Technology, 43 
            Vassar St., Cambridge, MA 02139, USA
REFERENCE   4  (bases 1 to 7421)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 7421)
  TITLE     Direct Submission
REFERENCE   6  (bases 1 to 7421)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Virology"; 
            date: "2000"; volume: "270"; issue: "1"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (06-DEC-2009) Brain and Cognitive Sciences, Howard Hughes Medical 
            Institute and Massachusetts Institute of Technology, 43 Vassar St., 
            Cambridge, MA 02139, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
COMMENT     SGRef: number: 5; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7421
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        63..366
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        368..642
                     /label=chicken beta-actin promoter
     intron          644..1659
                     /label=chimeric intron
                     /note="chimera between introns from chicken beta-actin and 
                     rabbit beta-globin"
     CDS             1750..4398
                     /codon_start=1
                     /label=T7 RNA polymerase
                     /note="T7 RNA polymerase from Escherichia phage T7.
                     Accession#: P00573"
                     /translation="MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYE
                     MGEARFRKMFERQLKAGEVADNAAAKPLITTLLPKMIARINDWFEEVKAKRGKRPTAFQ
                     FLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAKHFK
                     KNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIE
                     STGMVSLHRQNAGVVGQDSETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGI
                     TGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVANV
                     ITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKDKARKSRRISLE
                     FMLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYY
                     WLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFE
                     YAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSETVQDIYGIVAK
                     KVNEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSVTKRSVM
                     TLAYGSKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTVVAAVE
                     AMNWLKSAAKLLAAEVKDKKTGEILRKRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLG
                     QFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHEKYGIESFALIHD
                     SFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLN
                     LRDILESDFAFA"
     polyA_signal    4490..4545
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     primer_bind     complement(4906..4922)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4930..4946)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4954..4984)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4999..5020)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        5078..5274
                     /label=SV40 promoter
                     /note="SV40 early promoter"
     polyA_signal    5280..5414
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(5653..6241)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6415..7272)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(7273..7377)
                     /label=AmpR promoter
     promoter        7405..7421
                     /label=CAG
                     /note="CMV early enhancer fused to modified chicken
                     beta-actin promoter"