Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V010545 | pGreenII 0800-LUC | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
Helper plasmid eg: pSoup could faciliate its replication in Agrobacterium
- Vector Name:
- pGreenII 0800-LUC
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6388 bp
- Type:
- Plant Expression Vectors, Promoter Reporter Vector
- Replication origin:
- pSa ori
- Host:
- Plants
- Selection Marker:
- Luc
- Promoter:
- CaMV 35S
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
pGreenII 0800-LUC vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Zhang T, Chen X, Xiong Y, Niu M, Zhang Y, Yan H, Li Y, Zhang X, Ma G. Identification and Functional Analysis of SabHLHs in Santalum album L. Life (Basel). 2022 Jul 8;12(7):1017. doi: 10.3390/life12071017. PMID: 35888105; PMCID: PMC9315531.
- Wang L, Hou Q, Qiao G. Genome-Wide Identification and Expression Analysis of the Sweet Cherry Whirly Gene Family. Curr Issues Mol Biol. 2024 Jul 26;46(8):8015-8030. doi: 10.3390/cimb46080474. PMID: 39194691; PMCID: PMC11353091.
pGreenII 0800-LUC vector Sequence
LOCUS Exported 6388 bp DNA circular SYN 29-AUG-2024
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6388)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 6388)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 6388)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6388
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 969..976
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 4147..4151
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 534..556
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA
(truncated)"
promoter 618..963
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
CDS 982..1914
/label=Rluc
/note="luciferase from the anthozoan coelenterate Renilla
reniformis (sea pansy)"
polyA_signal 1972..2148
/label=CaMV poly(A) signal
/note="cauliflower mosaic virus polyadenylation signal"
primer_bind 2312..2328
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 2338..2356
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature complement(2365..2470)
/label=MCS
/note="pBluescript multiple cloning site"
CDS 2480..4129
/label=luciferase
/note="firefly luciferase"
polyA_signal 4194..4370
/label=CaMV poly(A) signal
/note="CaMV poly(A) signal"
/note="cauliflower mosaic virus polyadenylation signal"
misc_feature 4380..4404
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
rep_origin complement(4495..5083)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5257..6069)
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
rep_origin 6360..6388
/label=pSa ori
/note="origin of replication from bacterial plasmid pSa"