Basic Vector Information
- Vector Name:
- OpiE2-iFlp-Ieterm
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4413 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Vidigal J, Teixeira AP.
- Promoter:
- OpIE-2
OpiE2-iFlp-Ieterm vector Map
OpiE2-iFlp-Ieterm vector Sequence
LOCUS 40924_2284 4413 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector OpiE2-iFlp-Ieterm, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4413) AUTHORS Vidigal J, Teixeira AP. TITLE RMCE-based insect cell platform to produce membrane proteins captured on HIV-1 Gag virus-like particles JOURNAL Unpublished REFERENCE 2 (bases 1 to 4413) AUTHORS van den Heuvel JJ, Bleckmann M. TITLE Direct Submission JOURNAL Submitted (05-OCT-2017) Structure and Function of Proteins, Helmholtz Centre for Infection Research, Inhoffenstrasse 7, Braunschweig, Lower Saxony 38124, Germany REFERENCE 3 (bases 1 to 4413) TITLE Direct Submission REFERENCE 4 (bases 1 to 4413) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-OCT-2017) Structure and Function of Proteins, Helmholtz Centre for Infection Research, Inhoffenstrasse 7, Braunschweig, Lower Saxony 38124, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: VectorNTI v. 8 Sequencing Technology :: 454 ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4413 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 22..569 /label=OpIE-2 promoter /note="strong constitutive baculovirus promoter for insect cell expression" CDS 582..1877 /codon_start=1 /label=FLPo /note="nuclear-targeted site-specific recombinase" /translation="MAPKKKRKVMPQFGILCKTPPKVLVRQFVERFERPSGEKIASCAA ELTYLCWMITHNGTAIKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKK LIPAWEFTIIPYYGQKHQSDITDIVSRLQLQFESSEEADKGNSRSKKMLKALLSEGESI WEITEKILNSFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGV IIQCLVTETKTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEY QLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLTELTNVVGNWS DKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPIEEWQHIEQL KGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI" terminator 1893..2199 /label=IE1 terminator /note="terminator of the ie1 gene from the baculovirus Autographa californica" rep_origin complement(2553..3141) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(3608..3986) /label=ISS /note="immunostimulatory sequence from the AmpR gene; contains unmethylated CpG dinucleotides in the context of 5'-AACGTT-3' (Sato et al., 1996)" promoter complement(4171..4275) /label=AmpR promoter
This page is informational only.