Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012822 | pG-Tf2 | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
Plasmid pG-Tf2 could express TF and GroEL-GroES together under the tetracycline-inducible promoter (Pzt-1)
- Vector Name:
- pG-Tf2
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 8739 bp
- Type:
- E.coli expression plasmid
- Replication origin:
- p15A ori
- Source/Author:
- Takashi Yura
- Copy Number:
- Medium copy number
- Promoter:
- Pzt-1
- 5' Primer:
- GGTAGCTCAGAGAACCTTCG
- 3' Primer:
- gccatctcttcgatcaggc
- Growth Strain(s):
- DH5alpha
- Growth Temperature:
- 37℃
pG-Tf2 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Yasamut U, Thongheang K, Weechan A, Sornsuwan K, Juntit OA, Tayapiwatana C. Evaluating the ability of different chaperones in improving soluble expression of a triple-mutated human interferon gamma in Escherichia coli. J Biosci Bioeng. 2024;138(3):232-238. doi:10.1016/j.jbiosc.2024.06.005
pG-Tf2 vector Sequence
LOCUS Exported 8739 bp DNA circular SYN 10-OCT-2024 DEFINITION Exported. ACCESSION V012822 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8739) TITLE Direct Submission REFERENCE 2 (bases 1 to 8739) TITLE Direct Submission REFERENCE 3 (bases 1 to 8739) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..8739 /mol_type="other DNA" /organism="synthetic DNA construct" source 3573..3958 /mol_type="other DNA" /organism="synthetic DNA construct" source 4763..4822 /mol_type="other DNA" /organism="synthetic DNA construct" RBS 98..109 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 206..259 /label=S loop /note="GroES chaperone mobile loop that interacts with GroEL" CDS 498..2141 /gene="groEL" /label=Chaperonin GroEL /note="Chaperonin GroEL from Escherichia coli O8 (strain IAI1). Accession#: B7M8Q4" CDS 2202..3497 /label=Trigger Factor /note="ribosome-associated chaperone from E. coli (Hoffmann et al., 2010)" terminator 4833..4919 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" promoter complement(4979..5034) /label=tetR/tetA promoters /note="overlapping promoters for bacterial tetR and tetA" CDS 5050..5673 /label=TetR /note="tetracycline repressor TetR" CDS complement(6696..7352) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(7353..7455) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(7981..8526) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin."