Cart 2

pMV261 vector (V012795#)

Price Information

Cat No. Plasmid Name Availability Add to cart
V012795 pMV261 In stock (lyophilized plasmid)

Buy one, get one free!

Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.

Basic Vector Information

Plasmid DNA pMV261 is a replicative vector (multicopy, extrachromosomal) that contains a DNA cassette encoding kanamycin resistance (Tn903-derived aph gene), an E. coli origin of replication (oriE), a mycobacterial plasmid DNA origin of replication (oriM), an expression cassette containing a mycobacterial promoter, a multiple cloning site, and a transcriptional terminator.

Basic Vector Information
Vector Name pMV261 Antibiotic Resistance Kanamycin
Length 4488 bp Type Mycobacterium Expression Vector
Source Stover et al., 1991 Nature 351:456 Copy Number High copy number
Promoter Hsp60 Cloning Method Enzyme Cut

pMV261 vector Vector Map

KanR ori Mycobacterial OriM region derived from pAL5000 rrnB T1 terminator

pMV261 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                4488 bp ds-DNA     circular SYN 15-DEC-2021
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    pMV261
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4488)
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4488
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             121..936
                     /codon_start=1
                     /gene="aph(3')-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /note="KanR"
                     /note="confers resistance to kanamycin in bacteria or G418 
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPHAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHNLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      1268..1856
                     /direction=RIGHT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      2015..3910
                     /note="Mycobacterial OriM region derived from pAL5000"
     terminator      4406..4452
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"

Plasmid Resuspension protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.