Basic Vector Information
express the genetically-encoded fluorescent dopamine(DA) sensor GRAB_DA1h in neurons
- Vector Name:
- pAAV-hSyn-GRAB_DA1h
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6349 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Source/Author:
- Yulong Li
- Copy Number:
- High copy number
- Promoter:
- human synapsin
- Expression Method:
- Constiutive, Stable
pAAV-hSyn-GRAB_DA1h vector Map
pAAV-hSyn-GRAB_DA1h vector Sequence
LOCUS pAAV-hSyn-GRAB_D 6349 bp DNA circular SYN 09-APR-2021
DEFINITION natural circular DNA.
ACCESSION .
VERSION .
KEYWORDS pAAV-hSyn-GRAB_DA1h
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6349)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 6349)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6349
/mol_type="other DNA"
/organism="synthetic DNA construct"
repeat_region 1..141
/label=AAV2 ITR
/note="inverted terminal repeat of adeno-associated virus
serotype 2"
promoter 156..597
/note="synapsin"
CDS 598..660
/codon_start=1
/product="leader sequence from mouse immunoglobulin kappa
light chain"
/label=leader sequence from mouse immunoglobulin kappa
/note="Ig-kappa leader"
/translation="METDTLLLWVLLLWVPGSTGD"
protein_bind 661..685
/gene="mutant version of attB"
/label=BP Clonase(TM) binding site
/bound_moiety="BP Clonase(TM)"
/note="attB1"
/note="recombination site for the Gateway(R) BP reaction"
CDS 694..1446
/codon_start=1
/label=D(2) dopamine receptor(2-252)
/note="D(2) dopamine receptor(2-252)"
/translation="DPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIA
VIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRI
HCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSF
TISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVMLLVYIKIYIVLRRRRKRV
NTKRSSRAFRAHLRAPLKGNCTHPEDMKL"
CDS 1471..1722
/label=VC155
/note="C-terminal fragment of mVenus for use in bimolecular
fluorescence complementation (BiFC) (Kodama and Hu, 2010)"
CDS 2191..2451
/codon_start=1
/label=D(2) dopamine receptor(358-443)
/note="D(2) dopamine receptor(358-443)"
/translation="MSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCN
IPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC"
misc_feature 2476..3064
/label=WPRE
/note="woodchuck hepatitis virus posttranscriptional
regulatory element"
polyA_signal 3096..3572
/label=hGH poly(A) signal
/note="human growth hormone polyadenylation signal"
repeat_region 3612..3752
/label=AAV2 ITR
/note="inverted terminal repeat of adeno-associated virus
serotype 2"
rep_origin 3827..4282
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 4564..4668
/label=AmpR promoter
CDS 4669..5526
/label=AmpR
/note="beta-lactamase"
rep_origin 5700..6288
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.