pAAV-hSyn-GRAB_DA1h vector (V012732)

MSDS

Basic Vector Information

express the genetically-encoded fluorescent dopamine(DA) sensor GRAB_DA1h in neurons

Vector Name:: pAAV-hSyn-GRAB_DA1h

Antibiotic Resistance:: Ampicillin

Length:: 6349 bp

Type:: Viral Expression & Packaging Vectors

Replication origin:: ori

Source/Author:: Yulong Li

Copy Number:: High copy number

Promoter:: human synapsin

Expression Method:: Constiutive, Stable

pAAV-hSyn-GRAB_DA1h vector Vector Map

View Map in NovoBuilder

pAAV-hSyn-GRAB_DA1h vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       pAAV-hSyn-GRAB_D        6349 bp DNA     circular SYN 09-APR-2021
DEFINITION  natural circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    pAAV-hSyn-GRAB_DA1h
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6349)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 6349)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6349
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     repeat_region   1..141
                     /label=AAV2 ITR
                     /note="inverted terminal repeat of adeno-associated virus 
                     serotype 2"
     promoter        156..597
                     /note="synapsin"
     CDS             598..660
                     /codon_start=1
                     /product="leader sequence from mouse immunoglobulin kappa
                     light chain"
                     /label=leader sequence from mouse immunoglobulin kappa
                     /note="Ig-kappa leader"
                     /translation="METDTLLLWVLLLWVPGSTGD"
     protein_bind    661..685
                     /gene="mutant version of attB"
                     /label=BP Clonase(TM) binding site
                     /bound_moiety="BP Clonase(TM)"
                     /note="attB1"
                     /note="recombination site for the Gateway(R) BP reaction"
     CDS             694..1446
                     /codon_start=1
                     /label=D(2) dopamine receptor(2-252)
                     /note="D(2) dopamine receptor(2-252)"
                     /translation="DPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIA
                     VIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRI
                     HCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSF
                     TISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVMLLVYIKIYIVLRRRRKRV
                     NTKRSSRAFRAHLRAPLKGNCTHPEDMKL"
     CDS             1471..1722
                     /label=VC155
                     /note="C-terminal fragment of mVenus for use in bimolecular
                     fluorescence complementation (BiFC) (Kodama and Hu, 2010)"
     CDS             2191..2451
                     /codon_start=1
                     /label=D(2) dopamine receptor(358-443)
                     /note="D(2) dopamine receptor(358-443)"
                     /translation="MSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCN
                     IPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC"
     misc_feature    2476..3064
                     /label=WPRE
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     polyA_signal    3096..3572
                     /label=hGH poly(A) signal
                     /note="human growth hormone polyadenylation signal"
     repeat_region   3612..3752
                     /label=AAV2 ITR
                     /note="inverted terminal repeat of adeno-associated virus 
                     serotype 2"
     rep_origin      3827..4282
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        4564..4668
                     /label=AmpR promoter
     CDS             4669..5526
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      5700..6288
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.