Basic Vector Information
express the genetically-encoded fluorescent dopamine(DA) sensor GRAB_DA1h in neurons
- Vector Name:
- pAAV-hSyn-GRAB_DA1h
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6349 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Source/Author:
- Yulong Li
- Copy Number:
- High copy number
- Promoter:
- human synapsin
- Expression Method:
- Constiutive, Stable
pAAV-hSyn-GRAB_DA1h vector Vector Map
pAAV-hSyn-GRAB_DA1h vector Sequence
LOCUS pAAV-hSyn-GRAB_D 6349 bp DNA circular SYN 09-APR-2021 DEFINITION natural circular DNA. ACCESSION . VERSION . KEYWORDS pAAV-hSyn-GRAB_DA1h SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6349) TITLE Direct Submission REFERENCE 2 (bases 1 to 6349) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..6349 /mol_type="other DNA" /organism="synthetic DNA construct" repeat_region 1..141 /label=AAV2 ITR /note="inverted terminal repeat of adeno-associated virus serotype 2" promoter 156..597 /note="synapsin" CDS 598..660 /codon_start=1 /product="leader sequence from mouse immunoglobulin kappa light chain" /label=leader sequence from mouse immunoglobulin kappa /note="Ig-kappa leader" /translation="METDTLLLWVLLLWVPGSTGD" protein_bind 661..685 /gene="mutant version of attB" /label=BP Clonase(TM) binding site /bound_moiety="BP Clonase(TM)" /note="attB1" /note="recombination site for the Gateway(R) BP reaction" CDS 694..1446 /codon_start=1 /label=D(2) dopamine receptor(2-252) /note="D(2) dopamine receptor(2-252)" /translation="DPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIA VIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRI HCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSF TISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVMLLVYIKIYIVLRRRRKRV NTKRSSRAFRAHLRAPLKGNCTHPEDMKL" CDS 1471..1722 /label=VC155 /note="C-terminal fragment of mVenus for use in bimolecular fluorescence complementation (BiFC) (Kodama and Hu, 2010)" CDS 2191..2451 /codon_start=1 /label=D(2) dopamine receptor(358-443) /note="D(2) dopamine receptor(358-443)" /translation="MSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCN IPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC" misc_feature 2476..3064 /label=WPRE /note="woodchuck hepatitis virus posttranscriptional regulatory element" polyA_signal 3096..3572 /label=hGH poly(A) signal /note="human growth hormone polyadenylation signal" repeat_region 3612..3752 /label=AAV2 ITR /note="inverted terminal repeat of adeno-associated virus serotype 2" rep_origin 3827..4282 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4564..4668 /label=AmpR promoter CDS 4669..5526 /label=AmpR /note="beta-lactamase" rep_origin 5700..6288 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.