Basic Vector Information
express the genetically-encoded fluorescent dopamine(DA) sensor GRAB_DA1h in neurons
- Vector Name:
- pAAV-hSyn-GRAB_DA1h
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6349 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Source/Author:
- Yulong Li
- Copy Number:
- High copy number
- Promoter:
- human synapsin
- Expression Method:
- Constiutive, Stable
pAAV-hSyn-GRAB_DA1h vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pAAV-hSyn-GRAB_DA1h vector Sequence
LOCUS pAAV-hSyn-GRAB_D 6349 bp DNA circular SYN 09-APR-2021 DEFINITION natural circular DNA. ACCESSION . VERSION . KEYWORDS pAAV-hSyn-GRAB_DA1h. SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6349) TITLE Direct Submission REFERENCE 2 (bases 1 to 6349) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..6349 /mol_type="other DNA" /organism="synthetic DNA construct" repeat_region 1..141 /label=AAV2 ITR /note="inverted terminal repeat of adeno-associated virus serotype 2" promoter 156..597 /note="synapsin" CDS 598..660 /codon_start=1 /product="leader sequence from mouse immunoglobulin kappa light chain" /label=leader sequence from mouse immunoglobulin kappa /note="Ig-kappa leader" /translation="METDTLLLWVLLLWVPGSTGD" protein_bind 661..685 /gene="mutant version of attB" /label=BP Clonase(TM) binding site /bound_moiety="BP Clonase(TM)" /note="attB1" /note="recombination site for the Gateway(R) BP reaction" CDS 694..1446 /codon_start=1 /label=D(2) dopamine receptor(2-252) /note="D(2) dopamine receptor(2-252)" /translation="DPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIA VIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRI HCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSF TISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVMLLVYIKIYIVLRRRRKRV NTKRSSRAFRAHLRAPLKGNCTHPEDMKL" CDS 1471..1722 /label=VC155 /note="C-terminal fragment of mVenus for use in bimolecular fluorescence complementation (BiFC) (Kodama and Hu, 2010)" CDS 2191..2451 /codon_start=1 /label=D(2) dopamine receptor(358-443) /note="D(2) dopamine receptor(358-443)" /translation="MSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCN IPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC" misc_feature 2476..3064 /label=WPRE /note="woodchuck hepatitis virus posttranscriptional regulatory element" polyA_signal 3096..3572 /label=hGH poly(A) signal /note="human growth hormone polyadenylation signal" repeat_region 3612..3752 /label=AAV2 ITR /note="inverted terminal repeat of adeno-associated virus serotype 2" rep_origin 3827..4282 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4564..4668 /label=AmpR promoter CDS 4669..5526 /label=AmpR /note="beta-lactamase" rep_origin 5700..6288 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.