Price Information
Cat No. | Plasmid Name | Status | Add to cart |
---|---|---|---|
V001454 | pBAD18 |
Basic Vector Information
Vector backbone:pKK223-3 Article: Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. Guzman LM et al. (J Bacteriol. 1995 Jul . 177(14):4121-30. Pubmed)
Basic Vector Information | |||
---|---|---|---|
Vector Name | pBAD18 | Length | 4613 bp |
Type | E.coli vector; pBAD series expression plasmid | Source | Guzman LM et al. |
Promoter | araBAD |
pBAD18 vector Vector Map
pBAD18 vector Sequence
LOCUS Exported 4613 bp ds-DNA circular SYN 16-OCT-2020 DEFINITION synthetic circular DNA ACCESSION . VERSION . KEYWORDS pBAD18 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4613) AUTHORS caoheibi TITLE Direct Submission JOURNAL Exported Friday, October 16, 2020 from SnapGene 3.2.1 http://www.snapgene.com FEATURES Location/Qualifiers source 1..4613 /organism="synthetic DNA construct" /mol_type="other DNA" promoter 1..285 /gene="araBAD" /note="araBAD promoter" /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" misc_feature 306..362 /note="MCS" /note="pUC18/19 multiple cloning site" terminator 565..651 /gene="Escherichia coli rrnB" /note="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 743..770 /note="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" promoter 789..880 /gene="bla" /note="AmpR promoter" CDS 881..1741 /codon_start=1 /gene="bla" /product="beta-lactamase" /note="AmpR" /note="confers resistance to ampicillin, carbenicillin, and related antibiotics" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 1783..2238 /direction=RIGHT /note="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 2349..2937 /direction=RIGHT /note="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 3123..3263 /note="bom" /note="basis of mobility region from pBR322" CDS complement(3709..4587) /codon_start=1 /gene="araC" /product="L-arabinose regulatory protein" /note="araC" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS"
Plasmid Resuspension protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.