pBBR4pemIK vector (V015864)

LOCUS       62056_3735        5655 bp DNA     circular SYN 06-DEC-2019
DEFINITION  Cloning vector pBBR4pemIK, complete sequence.
ACCESSION   MN044101
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5655)
  AUTHORS   Burbank L, Wei W.
  TITLE     Broad-Host-Range Plasmids for Constitutive and Inducible Gene 
            Expression in the Absence of Antibiotic Selection
  JOURNAL   Microbiol Resour Announc 8 (36), e00769-19 (2019)
  PUBMED    31488530
REFERENCE   2  (bases 1 to 5655)
  AUTHORS   Burbank LP, Wei W.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2019) Crop Diseases Pests and Genetics Research 
            Unit, USDA Agricultural Research Service, 9611 S Riverbend Ave, 
            Parlier, CA 93648, USA
REFERENCE   3  (bases 1 to 5655)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Microbiol 
            Resour Announc"; date: "2019"; volume: "8"; issue: "36"; pages: 
            "e00769-19"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (06-JUN-2019) Crop Diseases Pests and Genetics Research Unit, USDA 
            Agricultural Research Service, 9611 S Riverbend Ave, Parlier, CA 
            93648, USA"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5655
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      1..770
                     /label=pBBR1 oriV
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"
     CDS             771..1430
                     /label=pBBR1 Rep
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"
     primer_bind     2140..2156
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        2166..2184
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     2217..2233
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(2293..2655)
                     /codon_start=1
                     /transl_table=11
                     /product="mRNA interferase PemK"
                     /label=mRNA interferase PemK
                     /protein_id="QDJ95324.1"
                     /translation="MGRCSSSRTRTDMKRGDVYMVDLEPTAGHEQRGHRPVVVISSERF
                     NRLTSCPVILPITNGGEFASRLGFAVELLGTITTGVVRCDQPRALDLLARNARKVESLP
                     PNILADVLAKAVTIFQ"
     CDS             complement(2616..2879)
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin PemI"
                     /label=antitoxin PemI
                     /protein_id="QDJ95325.1"
                     /translation="MHTTNLRKVGGSIMLAVPPAFLDQLHLEVGATVGLAVTDGRLVIE
                     PVLHPQYTLDQLLAEAEASGAYPLPPEEREWVDAPAVGRELI"
     primer_bind     complement(2972..2988)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(3018..3036)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(3057..3073)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(3081..3097)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3105..3135)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(3150..3171)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        3399..3470
                     /label=AmpR promoter
     CDS             3471..4328
                     /label=AmpR
                     /note="beta-lactamase"