Basic Vector Information
- Vector Name:
- pJN105
- Antibiotic Resistance:
- Gentamicin
- Length:
- 6055 bp
- Type:
- Expression vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Newman JR, Fuqua C.
- Promoter:
- araBAD
pJN105 vector Vector Map
pJN105 vector Sequence
LOCUS 40924_26321 6055 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pJN105, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6055) AUTHORS Newman JR, Fuqua C. TITLE Broad-host-range expression vectors that carry the L-arabinose-inducible Escherichia coli araBAD promoter and the araC regulator JOURNAL Gene 227 (2), 197-203 (1999) PUBMED 10023058 REFERENCE 2 (bases 1 to 6055) AUTHORS Newman JR, Fuqua C. TITLE Direct Submission JOURNAL Submitted (21-AUG-1999) Biology, Indiana University, JH142, 1001 E. 3rd St., Bloomington, IN 47405-6801, USA REFERENCE 3 (bases 1 to 6055) TITLE Direct Submission REFERENCE 4 (bases 1 to 6055) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "1999"; volume: "227"; issue: "2"; pages: "197-203" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-AUG-1999) Biology, Indiana University, JH142, 1001 E. 3rd St., Bloomington, IN 47405-6801, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6055 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(264..794) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(983..1011) /label=Pc promoter /note="class 1 integron promoter" protein_bind 1281..1302 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1317..1347 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1355..1371 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1379..1395 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 1416..1434 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind 1464..1480 /label=KS primer /note="common sequencing primer, one of multiple similar variants" CDS complement(1575..2450) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 2477..2761 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" primer_bind complement(2801..2817) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(2850..2868) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2878..2894) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(3604..4263) /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" rep_origin complement(4264..5033) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication"
This page is informational only.