Basic Vector Information
- Vector Name:
- pMON81312
- Antibiotic Resistance:
- Streptomycin
- Length:
- 10411 bp
- Type:
- Expression vector
- Replication origin:
- oriV
- Host:
- Plants
- Source/Author:
- Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
- Promoter:
- CaMV 35S
pMON81312 vector Map
pMON81312 vector Sequence
LOCUS V004681 10411 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004681 VERSION V004681 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10411) AUTHORS Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME. TITLE Expression of the Arabidopsis thaliana BBX32 Gene in Soybean Increases Grain Yield JOURNAL PLoS ONE 7 (2), E30717 (2012) PUBMED 22363475 REFERENCE 2 (bases 1 to 10411) AUTHORS Preuss SB. TITLE Direct Submission REFERENCE 3 (bases 1 to 10411) TITLE Direct Submission REFERENCE 4 (bases 1 to 10411) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "2"; pages: "E30717" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-JUL-2011) Yield " SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10411 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 156..180 /label="LB T-DNA repeat" /note="left border repeat from octopine Ach5 T-DNA" regulatory 481..1080 /label="derived from A. thaliana Act7" /note="derived from A. thaliana Act7" /regulatory_class="promoter" 5'UTR 1081..1718 /label="derived from A. thaliana Act7" /note="derived from A. thaliana Act7" CDS 1721..1948 /codon_start=1 /product="EPSPS CTP" /label="EPSPS CTP" /note="derived from A. thaliana ShkG" /protein_id="AEP17828.1" /translation="MAQVSRICNGVQNPSLISNLSKSSQRKSPLSVSLKTQQHPRAYPI SSSWGLKKSGMTLIGSELRPLKVMSSVSTAC" CDS 1949..3313 /gene="aroA" /label="3-phosphoshikimate 1-carboxyvinyltransferase" /note="3-phosphoshikimate 1-carboxyvinyltransferase from Agrobacterium sp. (strain CP4). Accession#: Q9R4E4" terminator 3323..3575 /label="NOS terminator" /note="nopaline synthase terminator and poly(A) signal" promoter 3897..4241 /label="CaMV 35S promoter" /note="strong constitutive promoter from cauliflower mosaic virus" CDS 4264..4938 /gene="BBX32" /label="B-box zinc finger protein 32" /note="B-box zinc finger protein 32 from Arabidopsis thaliana. Accession#: Q9LJB7" 3'UTR 4956..5270 /label="derived from G. barbadense E6" /note="derived from G. barbadense E6" misc_feature 5341..5365 /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA" misc_feature 5794..6682 /label="derived from E. coli aadA" /note="derived from E. coli aadA" CDS complement(5852..6640) /codon_start=1 /gene="aadA" /product="aminoglycoside adenylyltransferase (Murphy, 1985)" /label="SmR" /note="confers resistance to spectinomycin and streptomycin" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 7213..7801 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(7987..8127) /label="bom" /note="basis of mobility region from pBR322" CDS complement(8232..8420) /label="rop" /note="Rop protein, which maintains plasmids at low copy number" rep_origin 9709..10323 /label="oriV" /note="origin of replication for the bacterial F plasmid" rep_origin 9800..10331 /label="oriV" /note="incP origin of replication"
This page is informational only.