Basic Vector Information
- Vector Name:
- pMON74532
- Antibiotic Resistance:
- Streptomycin
- Length:
- 9754 bp
- Type:
- Expression vector
- Replication origin:
- oriV
- Host:
- Plants
- Source/Author:
- Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
- Promoter:
- CaMV 35S
pMON74532 vector Map
pMON74532 vector Sequence
LOCUS V004682 9754 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004682 VERSION V004682 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9754) AUTHORS Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME. TITLE Expression of the Arabidopsis thaliana BBX32 Gene in Soybean Increases Grain Yield JOURNAL PLoS ONE 7 (2), E30717 (2012) PUBMED 22363475 REFERENCE 2 (bases 1 to 9754) AUTHORS Preuss SB. TITLE Direct Submission REFERENCE 3 (bases 1 to 9754) TITLE Direct Submission REFERENCE 4 (bases 1 to 9754) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "2"; pages: "E30717" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-JUL-2011) Yield " SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9754 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 51..75 /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA" misc_feature complement(504..1392) /label="derived from E. coli aadA" /note="derived from E. coli aadA" CDS complement(562..1350) /codon_start=1 /gene="aadA" /product="aminoglycoside adenylyltransferase (Murphy, 1985)" /label="SmR" /note="confers resistance to spectinomycin and streptomycin" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 1923..2511 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2697..2837) /label="bom" /note="basis of mobility region from pBR322" CDS complement(2942..3130) /label="rop" /note="Rop protein, which maintains plasmids at low copy number" rep_origin 4398..5111 /label="oriV" /note="incP origin of replication" misc_feature 5277..5301 /label="LB T-DNA repeat" /note="left border repeat from octopine Ach5 T-DNA" regulatory 5602..6201 /label="derived from A. thaliana Act7" /note="derived from A. thaliana Act7" /regulatory_class="promoter" 5'UTR 6202..6839 /label="derived from A. thaliana Act7" /note="derived from A. thaliana Act7" CDS 6842..7069 /codon_start=1 /product="EPSPS CTP" /label="EPSPS CTP" /note="derived from A. thaliana ShkG" /protein_id="AEP17833.1" /translation="MAQVSRICNGVQNPSLISNLSKSSQRKSPLSVSLKTQQHPRAYPI SSSWGLKKSGMTLIGSELRPLKVMSSVSTAC" CDS 7070..8434 /gene="aroA" /label="3-phosphoshikimate 1-carboxyvinyltransferase" /note="3-phosphoshikimate 1-carboxyvinyltransferase from Agrobacterium sp. (strain CP4). Accession#: Q9R4E4" terminator 8444..8696 /label="NOS terminator" /note="nopaline synthase terminator and poly(A) signal" promoter 9018..9362 /label="CaMV 35S promoter" /note="strong constitutive promoter from cauliflower mosaic virus" 3'UTR 9420..9734 /label="derived from G. barbadense E6" /note="derived from G. barbadense E6"
This page is informational only.