pMHL120 vector (V004731)

LOCUS       V004731                13561 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004731
VERSION     V004731
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 13561)
  AUTHORS   Lee MH, Nittayajarn A, Ross RP, Rothschild CB, Parsonage D,
            Claiborne A, Rubens CE.
  TITLE     Characterization of Enterococcus faecalis alkaline phosphatase and
            use in identifying Streptococcus agalactiae secreted proteins
  JOURNAL   J. Bacteriol. 181 (18), 5790-5799 (1999)
   PUBMED   10482522
REFERENCE   2  (bases 1 to 13561)
  AUTHORS   Clancy A, Lee MH, Jones AL, Rubens CE.
  TITLE     Construction and characterization of transposon TnphoZ for the
            identification of genes encoding exported proteins in Streptococcus
            agalactiae
  JOURNAL   FEMS Microbiol. Lett. 241 (2), 257-264 (2004)
   PUBMED   15598541
REFERENCE   3  (bases 1 to 13561)
  AUTHORS   Lee MH, Clancy A, Jones AL, Nittayajarn A, Rubens CE.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAR-2001) Infectious Disease, Children's Hospital and
            Regional Medical Center, 4800 Sand Point Way NE, Seattle, WA 98105,
            USA
REFERENCE   4  (bases 1 to 13561)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 13561)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J.
            Bacteriol."; date: "1999"; volume: "181"; issue: "18"; pages:
            "5790-5799"
            SGRef: number: 2; type: "Journal Article"; journalName: "FEMS
            Microbiol. Lett."; date: "2004"; volume: "241"; issue: "2"; pages:
            "257-264"
            SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (19-MAR-2001) Infectious Disease, Children's Hospital and Regional
            Medical Center, 4800 Sand Point Way NE, Seattle, WA 98105, USA"
            SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13561
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     RBS             3821..3829
                     /label="Shine-Dalgarno sequence"
                     /note="full consensus sequence for ribosome-binding sites
                     upstream of start codons in E. coli; complementary to a
                     region in the 3' end of the 16S rRNA (Chen et al., 1994)"
     CDS             complement(4170..4904)
                     /gene="ermB"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis (strain ATCC 700802 / V583). Accession#: P20173"
     rep_origin      5356..5944
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     misc_feature    complement(6130..6270)
                     /label="bom"
                     /note="basis of mobility region from pBR322"
     CDS             complement(6375..6563)
                     /label="rop"
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
     CDS             complement(7204..8391)
                     /label="TcR"
                     /note="tetracycline efflux protein"
     promoter        complement(8439..8467)
                     /label="tet promoter"
                     /note="E. coli promoter for tetracycline efflux protein
                     gene"
     gene            complement(8683..10032)
                     /gene="phoZ"
                     /allele="phoZ2"
                     /label="phoZ"
                     /note="alkaline phosphatase; derived from Enterococcus
                     faecalis; expression is dependent upon integration event to
                     create in-frame start codon"
     CDS             10619..11410
                     /label="KanR"
                     /note="aminoglycoside phosphotransferase"
     CDS             complement(11817..12515)
                     /codon_start=1
                     /gene="repAts"
                     /product="temperature-sensitive RepA"
                     /label="repAts"
                     /protein_id="AAK27832.1"
                     /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
                     KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
                     YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
                     DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
                     VLDAETGEIK"
     gene            complement(11817..12515)
                     /gene="repAts"
                     /label="repAts"
     CDS             13127..13138
                     /label="Factor Xa site"
                     /note="Factor Xa recognition and cleavage site"