Basic Vector Information
- Vector Name:
- pLZ41
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3993 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Zhou L, Zhang K, Wanner BL.
- Promoter:
- rhaB
pLZ41 vector Map
pLZ41 vector Sequence
LOCUS 40924_29551 3993 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLZ41, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3993) AUTHORS Zhou L, Zhang K, Wanner BL. TITLE Chromosomal expression of foreign and native genes from regulatable promoters in Escherichia coli JOURNAL Methods Mol. Biol. 267, 123-134 (2004) PUBMED 15269420 REFERENCE 2 (bases 1 to 3993) AUTHORS Zhou L, Zhang K, Wanner BL. TITLE Direct Submission JOURNAL Submitted (13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall, West Lafayette, IN 47907, USA REFERENCE 3 (bases 1 to 3993) TITLE Direct Submission REFERENCE 4 (bases 1 to 3993) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Methods Mol. Biol. 267, 123-134 (2004)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall, West Lafayette, IN 47907, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3993 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 50..136 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 228..255 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 425..543 /label=rhaB promoter /note="promoter of the E. coli rhaBAD operon, conferring tight induction with L-rhamnose and repression with D-glucose in the presence of RhaR and RhaS (Giacalone et al., 2006)" promoter 581..685 /label=AmpR promoter CDS 686..1543 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" terminator 1634..1880 /label=lambda tL3 terminator /note="transcription terminator tL3 from phage lambda" protein_bind 1894..2211 /label=phage Phi-80 attP /note="attachment site of phage phi-80" rep_origin complement(2322..2710) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(2861..3517) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPKFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(3518..3620) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" misc_feature 3817..3993 /label=oriT2 /note="oriT2"
This page is informational only.