Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V010850 | pGreen 0029 | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
The pGreen0029 is a compact Agrobacterium binary vector with kanamycin-resistance genes for bacterial and plant transformation.
- Vector Name:
- pGreen 0029
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4632 bp
- Type:
- Plant Vectors
- Replication origin:
- pSa ori
- Host:
- Plants
- Source/Author:
- Hellens RP, Edwards EA, Leyland NR, Bean S, Mullineaux PM.
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- NOS
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pGreen 0029 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pGreen 0029 vector Sequence
LOCUS 40924_22578 4632 bp DNA circular SYN 01-JAN-1980 DEFINITION Compact Agrobacterium binary vector with a kanamycin-resistance genes for bacterial and plant transformation. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4632) AUTHORS Hellens RP, Edwards EA, Leyland NR, Bean S, Mullineaux PM. TITLE pGreen: a versatile and flexible binary Ti vector for Agrobacterium-mediated plant transformation. JOURNAL Plant Mol. Biol. 2000;42:819-32. PUBMED 10890530 REFERENCE 2 (bases 1 to 4632) AUTHORS pGreen website TITLE Direct Submission REFERENCE 3 (bases 1 to 4632) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Mol. Biol."; date: "2000"; volume: "42"; pages: "819-32" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT This plasmid must be transformed into an Agrobacterium strain that also carries a vector such as pSoup. FEATURES Location/Qualifiers source 1..4632 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(555..734) /label=NOS promoter /note="nopaline synthase promoter" primer_bind 981..997 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 1004..1022 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(1031..1138) /label=MCS /note="pBluescript multiple cloning site" promoter complement(1151..1169) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(1190..1206) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1214..1230) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1238..1269) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1284..1305) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." misc_feature 1544..1568 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin complement(1659..2247) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2351..3163) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYGLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 3454..3889 /label=pSa ori /note="origin of replication from bacterial plasmid pSa" misc_feature 4022..4044 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" terminator complement(4068..4319) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(join(4362..4632,1..521)) /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERGRTRMEAGLVDQDDLDEEHQ GLAPAELFARLKARMPDGEDLVVTQGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"