Basic Vector Information
- Vector Name:
- pGreenII 0229
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4448 bp
- Type:
- Plant Vectors
- Replication origin:
- pSa ori
- Source/Author:
- Hellens RP, Edwards EA, Leyland NR, Bean S, Mullineaux PM.
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pGreenII 0229 vector Map
pGreenII 0229 vector Sequence
LOCUS 40924_22598 4448 bp DNA circular SYN 01-JAN-1980 DEFINITION Agrobacterium binary vector with kanamycin-and bialophos/phosphinothricin-resistance genes. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4448) AUTHORS Hellens RP, Edwards EA, Leyland NR, Bean S, Mullineaux PM. TITLE pGreen: a versatile and flexible binary Ti vector for Agrobacterium-mediated plant transformation. JOURNAL Plant Mol. Biol. 2000;42:819-32. PUBMED 10890530 REFERENCE 2 (bases 1 to 4448) AUTHORS pGreen website TITLE Direct Submission REFERENCE 3 (bases 1 to 4448) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Mol. Biol."; date: "2000"; volume: "42"; pages: "819-32" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT This plasmid must be transformed into an Agrobacterium strain that also carries a vector such as pSoup. FEATURES Location/Qualifiers source 1..4448 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 63..498 /label=pSa ori /note="origin of replication from bacterial plasmid pSa" misc_feature 633..655 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" terminator complement(679..930) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(953..1501) /codon_start=1 /label=BlpR /note="phosphinothricin acetyltransferase" /translation="MSPERRPADIRRATEADMPAVCTIVNHYIQTSTVNFRTEPQEPQE WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF WQLDFSLPVPPRPVLPVTEI" promoter complement(1544..1721) /label=NOS promoter /note="nopaline synthase promoter" primer_bind 1968..1984 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 1991..2009 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(2018..2125) /label=MCS /note="pBluescript multiple cloning site" promoter complement(2138..2156) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(2177..2193) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2201..2217) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2225..2256) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2271..2292) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." misc_feature 2531..2555 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin complement(2646..3234) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3408..4220) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANVVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
This page is informational only.