Basic Vector Information
- Vector Name:
- pSI-DST2
- Antibiotic Resistance:
- Streptomycin
- Length:
- 4912 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Kriz A, Schmid K, Baumgartner N, Ziegler U, Berger I, Ballmer-Hofer K, Berger P.
- Promoter:
- CMV
pSI-DST2 vector Map
pSI-DST2 vector Sequence
LOCUS 40924_40257 4912 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pSI-DST2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4912) AUTHORS Kriz A, Schmid K, Baumgartner N, Ziegler U, Berger I, Ballmer-Hofer K, Berger P. TITLE A plasmid-based multigene expression system for mammalian cells JOURNAL Nat Commun 1, 120 (2010) PUBMED 21081918 REFERENCE 2 (bases 1 to 4912) AUTHORS Kriz A, Schmid K, Baumgartner N, Ziegler U, Berger I, Ballmer-Hofer K, Berger P. TITLE Direct Submission JOURNAL Submitted (11-OCT-2010) Laboratory of Biomolecular Research, Paul Scherrer Institut, OFLC / 101, Villigen PSI CH-5232, Switzerland REFERENCE 3 (bases 1 to 4912) TITLE Direct Submission REFERENCE 4 (bases 1 to 4912) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun 1, 120 (2010)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-OCT-2010) Laboratory of Biomolecular Research, Paul Scherrer Institut, OFLC / 101, Villigen PSI CH-5232, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4912 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 71..374 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 375..578 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 623..641 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 703..1410 /codon_start=1 /label=mTFP1 /note="monomeric teal (cyan) fluorescent protein (Ai et al., 2006)" /translation="MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDG TNTINLEVKEGAPLPFSYDILTTAFAYGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTF EDKGIVKVKSDISMEEDSFIYEIHLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLK GDVKHKLLLEGGGHHRVDFKTIYRAKKAVKLPDYHFVDHRIEILNHDKDYNKVTVYESA VARNSTDGMDELYK" protein_bind 1469..1490 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1505..1535 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1543..1559 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1567..1583 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" RBS 1610..1632 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 1757..2464 /codon_start=1 /label=GFP /note="Aequorea victoria green fluorescent protein" /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF ICTTGKLPVPWPTLVTTLCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVN FKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITHGMDELY" polyA_signal 2657..2881 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" CDS 3357..4145 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin complement(4451..4832) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" protein_bind complement(4874..4907) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)."
This page is informational only.