Basic Vector Information
- Vector Name:
- pSI-DGB2x
- Antibiotic Resistance:
- Gentamycin
- Length:
- 4308 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Kriz A, Schmid K, Baumgartner N, Ziegler U, Berger I, Ballmer-Hofer K, Berger P.
pSI-DGB2x vector Map
pSI-DGB2x vector Sequence
LOCUS 40924_40252 4308 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pSI-DGB2x, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4308) AUTHORS Kriz A, Schmid K, Baumgartner N, Ziegler U, Berger I, Ballmer-Hofer K, Berger P. TITLE A plasmid-based multigene expression system for mammalian cells JOURNAL Nat Commun 1, 120 (2010) PUBMED 21081918 REFERENCE 2 (bases 1 to 4308) AUTHORS Kriz A, Schmid K, Baumgartner N, Ziegler U, Berger I, Ballmer-Hofer K, Berger P. TITLE Direct Submission JOURNAL Submitted (11-OCT-2010) Laboratory of Biomolecular Research, Paul Scherrer Institut, OFLC / 101, Villigen PSI CH-5232, Switzerland REFERENCE 3 (bases 1 to 4308) TITLE Direct Submission REFERENCE 4 (bases 1 to 4308) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun 1, 120 (2010)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-OCT-2010) Laboratory of Biomolecular Research, Paul Scherrer Institut, OFLC / 101, Villigen PSI CH-5232, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4308 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 71..374 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 375..578 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 623..641 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 703..1419 /codon_start=1 /label=EBFP2 /note="enhanced blue variant of GFP (Ai et al., 2007)" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTL KFICTTGKLPVPWPTLVTTLSHGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GTYKTRAEVKFEGDTLVNRIELKGVDFKEDGNILGHKLEYNFNSHNIYIMAVKQKNGIK VNFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSVLSKDPNEKRDHMVLL EFRTAAGITLGMDELYK" protein_bind 1478..1499 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1514..1544 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1552..1568 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1576..1592 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" RBS 1619..1641 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 1766..2473 /codon_start=1 /label=GFP /note="Aequorea victoria green fluorescent protein" /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF ICTTGKLPVPWPTLVTTLCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVN FKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITHGMDELY" polyA_signal 2666..2890 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" CDS complement(3116..3646) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" rep_origin complement(3844..4225) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" protein_bind complement(4267..4300) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)."
This page is informational only.