Basic Vector Information
- Vector Name:
- pSI-AGR10
- Antibiotic Resistance:
- Gentamycin
- Length:
- 5192 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mansouri M, Bellon-Echeverria I, Rizk A, Ehsaei Z, Cianciolo Cosentino C, Silva CS, Xie Y, Boyce FM, Davis MW, Neuhauss SC, Taylor V, Ballmer-Hofer K, Berger I, Berger P.
- Promoter:
- Pc
pSI-AGR10 vector Map
pSI-AGR10 vector Sequence
LOCUS 40924_40197 5192 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pSI-AGR10, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5192)
AUTHORS Mansouri M, Bellon-Echeverria I, Rizk A, Ehsaei Z, Cianciolo
Cosentino C, Silva CS, Xie Y, Boyce FM, Davis MW, Neuhauss SC,
Taylor V, Ballmer-Hofer K, Berger I, Berger P.
TITLE Highly efficient baculovirus-mediated multigene delivery in primary
cells
JOURNAL Nat Commun 7, 11529 (2016)
PUBMED 27143231
REFERENCE 2 (bases 1 to 5192)
AUTHORS Mansouri M, Berger I, Berger P.
TITLE Direct Submission
JOURNAL Submitted (29-MAR-2016) Laboratory of Biomolecular Research, Paul
Scherrer Institute, OFLG-110, Villigen psi 5232, Switzerland
REFERENCE 3 (bases 1 to 5192)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5192)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun
7, 11529 (2016)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(29-MAR-2016) Laboratory of Biomolecular Research, Paul Scherrer
Institute, OFLG-110, Villigen psi 5232, Switzerland"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: Ape v. v. v2.0.49
Sequencing Technology :: 454; Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5192
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 190..778
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
mobile_element complement(913..1136)
/label=Tn7R
/note="mini-Tn7 element (right end of the Tn7 transposon)"
CDS complement(1206..1736)
/codon_start=1
/label=GmR
/note="gentamycin acetyltransferase"
/translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRS
EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
EEVMHFDIDPSTAT"
promoter complement(1925..1953)
/label=Pc promoter
/note="class 1 integron promoter"
protein_bind complement(2024..2057)
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
enhancer 2149..2452
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 2453..2656
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
promoter 2701..2719
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 2781..3488
/codon_start=1
/label=mCherry
/note="monomeric derivative of DsRed fluorescent protein
(Shaner et al., 2004)"
/translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG
TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF
EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK
GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA
EGRHSTGGMDELYK"
protein_bind 3547..3568
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 3583..3613
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 3621..3637
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 3645..3661
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
RBS 3688..3710
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
CDS 3835..4542
/codon_start=1
/label=GFP
/note="Aequorea victoria green fluorescent protein"
/translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF
ICTTGKLPVPWPTLVTTLCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN
YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVN
FKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF
VTAAGITHGMDELY"
polyA_signal 4735..4959
/label=bGH poly(A) signal
/note="bovine growth hormone polyadenylation signal"
mobile_element complement(5027..5192)
/label=Tn7L
/note="mini-Tn7 element (left end of the Tn7 transposon)"
This page is informational only.