Basic Vector Information
- Vector Name:
- pSI-AGL10
- Antibiotic Resistance:
- Gentamycin
- Length:
- 5201 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mansouri M, Bellon-Echeverria I, Rizk A, Ehsaei Z, Cianciolo Cosentino C, Silva CS, Xie Y, Boyce FM, Davis MW, Neuhauss SC, Taylor V, Ballmer-Hofer K, Berger I, Berger P.
- Promoter:
- Pc
pSI-AGL10 vector Vector Map
pSI-AGL10 vector Sequence
LOCUS 40924_40192 5201 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pSI-AGL10, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5201) AUTHORS Mansouri M, Bellon-Echeverria I, Rizk A, Ehsaei Z, Cianciolo Cosentino C, Silva CS, Xie Y, Boyce FM, Davis MW, Neuhauss SC, Taylor V, Ballmer-Hofer K, Berger I, Berger P. TITLE Highly efficient baculovirus-mediated multigene delivery in primary cells JOURNAL Nat Commun 7, 11529 (2016) PUBMED 27143231 REFERENCE 2 (bases 1 to 5201) AUTHORS Mansouri M, Berger I, Berger P. TITLE Direct Submission JOURNAL Submitted (29-MAR-2016) Laboratory of Biomolecular Research, Paul Scherrer Institute, OFLG-110, Villigen psi 5232, Switzerland REFERENCE 3 (bases 1 to 5201) TITLE Direct Submission REFERENCE 4 (bases 1 to 5201) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun 7, 11529 (2016)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-MAR-2016) Laboratory of Biomolecular Research, Paul Scherrer Institute, OFLG-110, Villigen psi 5232, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: Ape v. v. v2.0.49 Sequencing Technology :: 454; Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5201 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 190..778 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" mobile_element complement(913..1136) /label=Tn7R /note="mini-Tn7 element (right end of the Tn7 transposon)" CDS complement(1206..1736) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(1925..1953) /label=Pc promoter /note="class 1 integron promoter" protein_bind complement(2024..2057) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." enhancer 2149..2452 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 2453..2656 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 2701..2719 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 2781..3497 /codon_start=1 /label=mEYFP /note="enhanced YFP with monomerizing A206K mutation (Zacharias et al., 2002)" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLL EFVTAAGITHGMDELYK" protein_bind 3556..3577 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3592..3622 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3630..3646 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 3654..3670 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" RBS 3697..3719 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 3844..4551 /codon_start=1 /label=GFP /note="Aequorea victoria green fluorescent protein" /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF ICTTGKLPVPWPTLVTTLCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVN FKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITHGMDELY" polyA_signal 4744..4968 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" mobile_element complement(5036..5201) /label=Tn7L /note="mini-Tn7 element (left end of the Tn7 transposon)"
This page is informational only.