Basic Vector Information
- Vector Name:
- pSHAFT-GFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4565 bp
- Type:
- Suicide vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Shastri S, Spiewak HL, Sofoluwe A, Eidsvaag VA, Asghar AH, Pereira T, Bull EH, Butt AT, Thomas MS.
pSHAFT-GFP vector Map
pSHAFT-GFP vector Sequence
LOCUS 40924_40112 4565 bp DNA circular SYN 18-DEC-2018 DEFINITION Suicide vector pSHAFT-GFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4565) AUTHORS Shastri S, Spiewak HL, Sofoluwe A, Eidsvaag VA, Asghar AH, Pereira T, Bull EH, Butt AT, Thomas MS. TITLE An efficient system for the generation of marked genetic mutants in members of the genus Burkholderia JOURNAL Plasmid (2016) In press PUBMED 27825973 REFERENCE 2 (bases 1 to 4565) AUTHORS Shastri S, Spiewak HL, Pereira T, Sofoluwe AO, Eidsvaag VA, Bull EH, Asghar AH, Thomas MS. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 4565) TITLE Direct Submission REFERENCE 4 (bases 1 to 4565) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid (2016) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-JUN-2016) Department of Infection, Immunity " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4565 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(16..723) /codon_start=1 /label=GFP /note="Aequorea victoria green fluorescent protein" /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF ICTTGKLPVPWPTLVTTLCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVN FKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITHGMDELY" RBS complement(737..759) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" misc_feature 898..916 /label=O end /note="O end" protein_bind complement(928..944) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." rep_origin complement(979..1367) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(1988..2356) /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" oriT complement(2389..2498) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS complement(3579..4436) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(4437..4541) /label=AmpR promoter
This page is informational only.