Basic Vector Information
- Vector Name:
- pSG-CaGFP-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6444 bp
- Type:
- Integrating GFP expression vector
- Replication origin:
- ori
- Source/Author:
- Galuska S, Donald RGK., Muise E, Wiersma HI, Diaz C, Kulkarni A, Cavet G, Roemer T, Liberator P, Douglas C.
pSG-CaGFP-1 vector Map
pSG-CaGFP-1 vector Sequence
LOCUS V003278 6444 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003278 VERSION V003278 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6444) AUTHORS Galuska S, Donald RGK., Muise E, Wiersma HI, Diaz C, Kulkarni A, Cavet G, Roemer T, Liberator P, Douglas C. TITLE A Candida albicans GFP reporter assay for identifying inhibitors of cell wall biosynthesis JOURNAL Unpublished REFERENCE 2 (bases 1 to 6444) AUTHORS Galuska S. TITLE Direct Submission REFERENCE 3 (bases 1 to 6444) TITLE Direct Submission REFERENCE 4 (bases 1 to 6444) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-MAR-2009) Infectious Diseases, Merck " SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6444 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 241..1653 /codon_start=1 /product="ARG4" /label="ARG4" /note="contains unique NotI site" /protein_id="ADD22644.1" /translation="MSQQQDKQPSENKLWGGRFTGATDPLMDLYNASLPYDKVMYDADL TGTKVYTQGLNKLGLITTEELHLIHQGLEQIRQEWHDNKFIIKAGDEDIHTANERRLGE IIGKNISGKVHTGRSRNDQVATDMRIFVRESLLNLSKILHQFITAILERAHKEIDVLMP GYTHLQKAQPIRWAHWLSSYATYFTEDYKRLQEIITRVNQSPLGSGALAGHPYGIDREF LAKGLGFDGVIGNSLTAVSDRDFVVESLFWSTLFMNHISRFSEDLIIYSSGEFGFIKLA AADAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLSGFLMSIKSIPSTYNKDMQEDKEP LFDALTTVEHSILIATGVISTLLIDKQNMEKALTMDMLATDLADYLVRKGVPFRETHHI SGECVRKAEEEKLSGIDQLSFEQFQQIDSRFEKDVMETFDFEASVERRDAIGGTAKSAV LKQLENLKSILS" misc_feature 1081..1088 /note="NotI site; inserted in ARG4 to facilitate targeted integration at the ARG4 locus of Candida albicans transformants" primer_bind 1910..1926 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS 1972..2676 /label="yeGFP" /note="yeast-enhanced green fluorescent protein" primer_bind complement(2864..2880) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2888..2904) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2912..2942) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(2957..2978) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3266..3854) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4028..4885) /label="AmpR" /note="beta-lactamase" promoter complement(4886..4990) /label="AmpR promoter" CDS 5435..6244 /gene="URA3" /label="Orotidine 5'-phosphate decarboxylase" /note="Orotidine 5'-phosphate decarboxylase from Candida albicans (strain SC5314 / ATCC MYA-2876). Accession#: P13649"
This page is informational only.