Basic Vector Information
- Vector Name:
- pSFFLAG-MAC
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6886 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Couch RD, Seidle HF, Parry RJ.
- Promoter:
- tac
pSFFLAG-MAC vector Map
pSFFLAG-MAC vector Sequence
LOCUS 40924_39788 6886 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pSFFLAG-MAC, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6886) AUTHORS Couch RD, Seidle HF, Parry RJ. TITLE Construction of Expression Vectors to Produce Affinity Tagged Proteins in Pseudomonas JOURNAL Unpublished REFERENCE 2 (bases 1 to 6886) AUTHORS Couch RD, Seidle HF, Parry RJ. TITLE Direct Submission JOURNAL Submitted (19-DEC-2001) Chemistry, Rice University, 1900 Rice Blvd MS60, Houston, TX 77005, USA REFERENCE 3 (bases 1 to 6886) TITLE Direct Submission REFERENCE 4 (bases 1 to 6886) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-DEC-2001) Chemistry, Rice University, 1900 Rice Blvd MS60, Houston, TX 77005, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6886 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 39..67 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 75..91 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 115..138 /codon_start=1 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" /translation="DYKDDDDK" terminator 377..463 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 555..582 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 601..692 /label=AmpR promoter CDS 693..1550 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRHDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 1724..2312 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" rep_origin complement(2924..3275) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 3289..4119 /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" primer_bind 4283..4299 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 4370..4821 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(4923..5096) /codon_start=1 /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase" /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART DRPSQQLRSLNGE" protein_bind complement(5116..5132) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5140..5170) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(5185..5206) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(5222..6301) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(6302..6379) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold."
This page is informational only.