Basic Vector Information
- Vector Name:
- pSEVA428
- Antibiotic Resistance:
- Streptomycin
- Length:
- 5840 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Silva-Rocha R, Martinez-Garcia E, Chavarria M, Calles B, Arce-Rodriguez A, de las Heras A, Paez-Espino D, Durante-Rodriguez G, Kim J, Nikel PI, Platero R, de Lorenzo V.
- Promoter:
- Pm
pSEVA428 vector Map
pSEVA428 vector Sequence
LOCUS 40924_39498 5840 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pSEVA428, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5840) AUTHORS Silva-Rocha R, Martinez-Garcia E, Chavarria M, Calles B, Arce-Rodriguez A, de las Heras A, Paez-Espino D, Durante-Rodriguez G, Kim J, Nikel PI, Platero R, de Lorenzo V. TITLE The Standard European Vector Architecture (SEVA): a coherent platform for analysis and deployment of complex prokaryotic phenotypes JOURNAL Unpublished REFERENCE 2 (bases 1 to 5840) AUTHORS Silva-Rocha R, Martinez-Garcia E, Chavarria M, Calles B, Arce-Rodriguez A, de las Heras A, Paez-Espino D, Durante-Rodriguez G, Kim J, Nikel PI, Platero R, de Lorenzo V. TITLE Direct Submission JOURNAL Submitted (28-AUG-2012) Systems Biology Program, Centro Nacional de Biotecnologia-CSIC, C/ Darwin 3, Campus de Cantoblanco, Madrid, Madrid 28049, Spain REFERENCE 3 (bases 1 to 5840) TITLE Direct Submission REFERENCE 4 (bases 1 to 5840) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-AUG-2012) Systems Biology Program, Centro Nacional de Biotecnologia-CSIC, C/ Darwin 3, Campus de Cantoblanco, Madrid, Madrid 28049, Spain" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: ApE v. v2.0.40 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5840 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(22..984) /codon_start=1 /label=XylS /note="XylS regulator encoded by the Pseudomonas putida TOL plasmid pWWO" /translation="MDFCLLNEKSQIFVHAEPYAVSDYVNQYVGTHSIRLPKGGRPAGR LHHRIFGCLDLCRISYGGSVRVISPGLETCYHLQIILKGHCLWRGHGQEHYFAPGELLL LNPDDQADLTYSEDCEKFIVKLPSVVLDRACSDNNWHKPREGIRFAARHNLQQLDGFIN LLGLVCDEAEHTKSMPRVQEHYAGIIASKLLEMLGSNVSREIFSKGNPSFERVVQFIEE NLKRNISLERLAELAMMSPRSLYNLFEKHAGTTPKNYIRNRKLESIRACLNDPSANVRS ITEIALDYGFLHLGRFAENYRSAFGELPSDTLRQCKKEVA" promoter 1884..1964 /label=Pm promoter /note="The bacterial Pm promoter is activated by XylS in the presence of benzoate or m-toluate (Marques et al., 1999)." misc_feature 2014..2070 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(2079..2102) /label=R24 /note="R24" terminator 2113..2207 /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS 2443..3231 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" oriT 3380..3488 /label=oriT /note="incP origin of transfer" CDS complement(3552..4697) /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS IVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" rep_origin complement(5090..5621) /direction=LEFT /label=oriV /note="incP origin of replication" terminator complement(5748..5834) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.