Basic Vector Information
pSET4s, pSET5s, and pSET6s are three thermosensitive (Ts) suicide vectors used for gene replacement in Streptococcus suis. These vectors could be propagated at 37°C in Escherichia coli, but their replication was blocked above 37°C in S. suis. orfC, replication regulatory protein; repATs, thermosensitive replication initiation–termination protein.
- Vector Name:
- pSET6s
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4438 bp
- Type:
- Thermosensitive suicide vector
- Replication origin:
- ori
- Source/Author:
- Takamatsu D, Osaki M, Sekizaki T.
- Growth Strain(s):
- DH5alpha
- Growth Temperature:
- 37℃
pSET6s vector Map
pSET6s vector Sequence
LOCUS V003381 4438 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V003381
VERSION V003381
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 4438)
AUTHORS Takamatsu D, Osaki M, Sekizaki T.
TITLE Thermosensitive suicide vectors for gene replacement in
Streptococcus suis
JOURNAL Plasmid 46 (2), 140-148 (2001)
PUBMED 11591139
REFERENCE 2 (bases 1 to 4438)
AUTHORS Takamatsu D, Osaki M, Sekizaki T.
TITLE Direct Submission
JOURNAL Submitted (08-FEB-2001) Daisuke Takamatsu, National Institute of
Animal Health, Laboratory of Molecular Bacteriology; Kannondai
3-1-1, Tsukuba, Ibaraki 305-0856, Japan
(E-mail:p1013dt@niah.affrc.go.jp, Tel:81-298-38-7743,
Fax:81-298-38-7743)
REFERENCE 3 (bases 1 to 4438)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4438)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid";
date: "2001"; volume: "46"; issue: "2"; pages: "140-148"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(08-FEB-2001) Daisuke Takamatsu, National Institute of Animal
Health, Laboratory of Molecular Bacteriology"; volume: " Kannondai
3-1-1, Tsukuba, Ibaraki 305-0856, Japan
(E-mail:p1013dt@niah.affrc.go.jp, Tel:81-298-38-7743, Fax"; pages:
"81-298-38-7743"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4438
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(133..144)
/label="Factor Xa site"
/note="Factor Xa recognition and cleavage site"
CDS 528..689
/codon_start=1
/gene="orfC"
/product="OrfC"
/label="orfC"
/protein_id="BAB64888.1"
/translation="MVISESKKRVMISLTKEQDKKLTDMAKQKGFSKSAVAALAIEEYA
RKESEQKK"
gene 528..689
/gene="orfC"
/label="orfC"
CDS 756..1454
/codon_start=1
/gene="repAts"
/product="RepAts"
/label="repAts"
/protein_id="BAB64889.1"
/translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
VLDAETGEIK"
gene 756..1454
/gene="repAts"
/label="repAts"
primer_bind 2036..2052
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 2053..2109
/label="MCS"
/note="pUC18/19 multiple cloning site"
primer_bind complement(2122..2138)
/label="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(2146..2162)
/label="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(2170..2200)
/label="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind complement(2215..2236)
/label="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(2524..3112)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3575..4222)
/gene="cat"
/label="Chloramphenicol acetyltransferase"
/note="Chloramphenicol acetyltransferase from
Staphylococcus aureus. Accession#: P00485"
This page is informational only.