Basic Vector Information
pSET4s, pSET5s, and pSET6s are three thermosensitive (Ts) suicide vectors used for gene replacement in Streptococcus suis. These vectors could be propagated at 37°C in Escherichia coli, but their replication was blocked above 37°C in S. suis. orfC, replication regulatory protein; repATs, thermosensitive replication initiation–termination protein.
- Vector Name:
- pSET5s
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4438 bp
- Type:
- Thermosensitive suicide vector
- Replication origin:
- ori
- Source/Author:
- Takamatsu D, Osaki M, Sekizaki T.
- Growth Strain(s):
- DH5alpha
- Growth Temperature:
- 37℃
pSET5s vector Vector Map
pSET5s vector Sequence
LOCUS V003382 4438 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003382 VERSION V003382 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4438) AUTHORS Takamatsu D, Osaki M, Sekizaki T. TITLE Thermosensitive suicide vectors for gene replacement in Streptococcus suis JOURNAL Plasmid 46 (2), 140-148 (2001) PUBMED 11591139 REFERENCE 2 (bases 1 to 4438) AUTHORS Takamatsu D, Osaki M, Sekizaki T. TITLE Direct Submission JOURNAL Submitted (08-FEB-2001) Daisuke Takamatsu, National Institute of Animal Health, Laboratory of Molecular Bacteriology; Kannondai 3-1-1, Tsukuba, Ibaraki 305-0856, Japan (E-mail:p1013dt@niah.affrc.go.jp, Tel:81-298-38-7743, Fax:81-298-38-7743) REFERENCE 3 (bases 1 to 4438) TITLE Direct Submission REFERENCE 4 (bases 1 to 4438) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2001"; volume: "46"; issue: "2"; pages: "140-148" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-FEB-2001) Daisuke Takamatsu, National Institute of Animal Health, Laboratory of Molecular Bacteriology"; volume: " Kannondai 3-1-1, Tsukuba, Ibaraki 305-0856, Japan (E-mail:p1013dt@niah.affrc.go.jp, Tel:81-298-38-7743, Fax"; pages: "81-298-38-7743" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4438 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(133..144) /label="Factor Xa site" /note="Factor Xa recognition and cleavage site" CDS 528..689 /codon_start=1 /gene="orfC" /product="OrfC" /label="orfC" /protein_id="BAB64884.1" /translation="MVISESKKRVMISLTKEQDKKLTDMAKQKGFSKSAVAALAIEEYA RKESEQKK" gene 528..689 /gene="orfC" /label="orfC" CDS 756..1454 /codon_start=1 /gene="repAts" /product="RepAts" /label="repAts" /protein_id="BAB64885.1" /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK VLDAETGEIK" gene 756..1454 /gene="repAts" /label="repAts" primer_bind 2036..2052 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" misc_feature 2053..2109 /label="MCS" /note="pUC18/19 multiple cloning site" primer_bind complement(2122..2138) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2146..2162) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2170..2200) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(2215..2236) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2524..3112) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 3593..4240 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485"
This page is informational only.