Basic Vector Information
- Vector Name:
- pSCANS-1-BNL
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4427 bp
- Type:
- Cloning vector
- Replication origin:
- ori2
- Source/Author:
- Dunn JJ.
- Promoter:
- SP6
pSCANS-1-BNL vector Vector Map
pSCANS-1-BNL vector Sequence
LOCUS 40924_38938 4427 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pSCANS-1-BNL, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4427) AUTHORS Dunn JJ. TITLE Direct Submission JOURNAL Submitted (30-SEP-1999) Biology Dept., Brookhaven National Laboratory, 463 Bell Ave., Upton, NY 11973-5000, USA REFERENCE 2 (bases 1 to 4427) TITLE Direct Submission REFERENCE 3 (bases 1 to 4427) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (30-SEP-1999) Biology Dept., Brookhaven National Laboratory, 463 Bell Ave., Upton, NY 11973-5000, USA" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4427 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..813 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" promoter 961..979 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" promoter 984..1002 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter complement(1096..1114) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(1125..1141) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin complement(1237..1285) /direction=LEFT /label=f1 /note="f1" misc_feature complement(1359..1609) /label=incC /note="incompatibility region of the bacterial F plasmid" CDS complement(1615..2367) /codon_start=1 /label=repE /note="replication initiation protein for the bacterial F plasmid" /translation="MAETAVINHKKRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQ IRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRPEEDAG DEKGYESFPWFIKRAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAM RLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPM RLSYIEKKKGRQTTHIVFSFRDITSMTTG" rep_origin complement(2458..2677) /direction=LEFT /label=ori2 /note="secondary origin of replication for the bacterial F plasmid; also known as oriS" protein_bind 3097..3118 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3133..3163 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3171..3187 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 3195..3211 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 3284..4129 /codon_start=1 /gene="repL" /product="RepL" /label=repL /protein_id="AAF23897.1" /translation="MLAKVTFLSCITMSDFTFSGYELACFVTHSGLSRSAGHILSQCAN LAATTSEYFIHKPHRLIAAETGYSQSTVVRAFREAVNKGILSVEIVIGDHRERRANLYR FTPSFLAFAQQAKNALIESKLKISSAATKVKAVLAKTLALFNFLSTPPCQNDTPSPCQD DVAIKNKKSQVKKTKRSVSGGAGTTSLKKLTSWIAKAKAKADNLRLSKKRTQKHEFKQK VEAAARKYAYLKNKRSPDIGGISNFDNLPHCMTVNEALNAVLAKNKDNEQWGIPAGFRG " gene 3284..4129 /gene="repL" /label=repL
This page is informational only.