Basic Vector Information
- Vector Name:
- pSC189
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6982 bp
- Type:
- Transposon delivery vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Chiang SL, Rubin EJ.
- Promoter:
- T3
pSC189 vector Vector Map
pSC189 vector Sequence
LOCUS 40924_38843 6982 bp DNA circular SYN 18-DEC-2018 DEFINITION Transposon delivery vector pSC189, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6982) AUTHORS Chiang SL, Rubin EJ. TITLE Construction of a mariner-based transposon for epitope-tagging and genomic targeting JOURNAL Gene 296 (1-2), 179-185 (2002) PUBMED 12383515 REFERENCE 2 (bases 1 to 6982) AUTHORS Chiang SL, Rubin EJ. TITLE Direct Submission JOURNAL Submitted (28-MAY-2002) Microbiology, Harvard Medical School, 200 Longwood Avenue, Armenise I-427, Boston, MA 02115, USA REFERENCE 3 (bases 1 to 6982) TITLE Direct Submission REFERENCE 4 (bases 1 to 6982) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene 296 (1-2), 179-185 (2002)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-MAY-2002) Microbiology, Harvard Medical School, 200 Longwood Avenue, Armenise I-427, Boston, MA 02115, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6982 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 171..1217 /codon_start=1 /product="mariner transposase C9 mutant" /label=mariner transposase C9 mutant /protein_id="AAM82289.1" /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH IIHQYLDMRKLCAKWVPRELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLH HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI ALEGNYVE" promoter complement(1280..1298) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 1635..1656 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1671..1701 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1709..1725 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1733..1749 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 1770..1788 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" repeat_region 1801..1827 CDS 1843..1908 /label=3xFLAG /note="three tandem FLAG(R) epitope tags, followed by an enterokinase cleavage site" protein_bind 1912..1959 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." promoter complement(1978..1996) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin 2204..2592 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" primer_bind complement(2729..2745) /label=KS primer /note="common sequencing primer, one of multiple similar variants" CDS 3143..3934 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" protein_bind 3971..4018 /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." repeat_region 4032..4058 promoter complement(4071..4089) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4096..4112) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(4681..5049) /label=traJ /note="oriT-recognizing protein" oriT complement(5082..5191) /direction=LEFT /label=oriT /note="incP origin of transfer" promoter 5861..5965 /label=AmpR promoter CDS 5966..6823 /label=AmpR /note="beta-lactamase"
This page is informational only.