Basic Vector Information
- Vector Name:
- pRV-9
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10427 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Nishizawa M, Fu SL, Kataoka K, Vogt PK.
- Promoter:
- RSV
pRV-9 vector Map
pRV-9 vector Sequence
LOCUS V003539 10427 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003539 VERSION V003539 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10427) AUTHORS Nishizawa M, Fu SL, Kataoka K, Vogt PK. TITLE Artificial oncoproteins: modified versions of the yeast bZip protein GCN4 induce cellular transformation JOURNAL Oncogene 22 (39), 7931-7941 (2003) PUBMED 12970741 REFERENCE 2 (bases 1 to 10427) AUTHORS Nishizawa M, Fu S-L., Kataoka K, Vogt PK. TITLE Direct Submission JOURNAL Submitted (15-FEB-2002) Dept. of Molecular and Experimental Medicine, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA REFERENCE 3 (bases 1 to 10427) TITLE Direct Submission REFERENCE 4 (bases 1 to 10427) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Oncogene"; date: "2003"; volume: "22"; issue: "39"; pages: "7931-7941" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-FEB-2002) Dept. of Molecular and Experimental Medicine, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10427 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 411..676 /label="RSV promoter" /note="Rous sarcoma virus enhancer/promoter" misc_feature 745..762 /note="tRNA-Trp primer binding site for reverse transcription" CDS 2752..3123 /gene="gag" /label="Proteinase p15" /note="Proteinase p15 from Avian myeloblastosis associated virus. Accession#: P26315" CDS 3144..5831 /codon_start=1 /gene="pol" /product="reverse trascriptase" /label="pol" /note="RNA-dependent DNA polymerase; derived from Bryan high-titer strain" /protein_id="AAL91562.1" /translation="TVALHLAIPLKWKSDRTPVWIDQWPLPEGKLVALTQLVEKELQLG HIEPSLSCWNTPVFVIRKASGSYRLLHDLRAVNAKLVPFGAVQQGAPVLSALPRGWPLM VLDLKDCFFSIPLAEQDREAFAFTLPSVNNQAPARRFQWKVLPQGMTCSPTICQLVVGQ VLEPLRLKHPALRMLHYMDDLLLAASSHDGLEAAGKEVIGTLERAGFTISPDKIQREPG VQYLGYKLGSTYVAPVGLVAEPRIATLWDVQKLVGSLQWLRPALGIPPRLMGPFYEQLR GSDPNEAREWNLDMKMAWREIVQLSTTAALERWDPAQPLEGAVARCEQGAIGVLGQGLS THPRPCLWLFSTQPTKAFTAWLEVLTLLITKLRASAVRTFGKEVDILLLPACFREDLPL PEGILLALRGFAGKIRSSDTPSIFDIARPLHVSLKVRVTDHPVPGPTVFTDASSSTHKG VVVWREGPRWEIKEIVDLGASVQQLEARAVAMALLLWPTTPTNVVTDSAFVAKMLLKMG QEGVPSTAAAFILEDALSQRSAMAAVLHVRSHSEVPGFFTEGNDVADSQATFQAYPLRE AKDLHTALHIGPRALSKACNISMQQAREVVQTCPHCNSAPALEAGVNPRGLGPLQIWQT DFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDN GSCFTSRSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIP TSKQGELLAKAMYALNHFERGENTKTPIQKHWRPTVLTEGPPVKIRIETGEWEKGWNVL VWGRGYAAVKNRDTDKVIWVPSRKVKPDVTQKDEVTKKDEASPLFAGISDWIPWEDEQE GLQGETASNKQERPGEDTLAANES" gene 3144..5831 /gene="pol" /label="pol" CDS 6784..7521 /gene="env" /label="Envelope glycoprotein gp95" /note="Envelope glycoprotein gp95 from Rous sarcoma virus subgroup A (strain Schmidt-Ruppin). Accession#: P0DTM5" misc_feature 7674..7722 /label="polylinker sequence" /note="polylinker sequence" repeat_region 7835..8167 primer_bind complement(8206..8222) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind 8230..8246 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(8254..8284) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(8299..8320) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(8608..9196) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(9370..10227) /label="AmpR" /note="beta-lactamase" promoter complement(10228..10332) /label="AmpR promoter"
This page is informational only.