Basic Vector Information
- Vector Name:
- pTLR7-A-SEAP
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6883 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mejia JE, Azar P, Guery J-C.
- Promoter:
- EF-1α
pTLR7-A-SEAP vector Map
pTLR7-A-SEAP vector Sequence
LOCUS 40924_43593 6883 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTLR7-A-SEAP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6883) AUTHORS Mejia JE, Azar P, Guery J-C. TITLE Functional study of the rs179008 single-nucleotide polymorphism of human TLR7 JOURNAL Unpublished REFERENCE 2 (bases 1 to 6883) AUTHORS Mejia JE, Azar P, Guery J-C. TITLE Direct Submission JOURNAL Submitted (07-APR-2016) Centre de Physiopathologie de Toulouse-Purpan, Inserm, CHU Purpan, BP 3028, Toulouse Cedex 3 31024, France REFERENCE 3 (bases 1 to 6883) TITLE Direct Submission REFERENCE 4 (bases 1 to 6883) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-APR-2016) Centre de Physiopathologie de Toulouse-Purpan, Inserm, CHU Purpan, BP 3028, Toulouse Cedex 3 31024, France" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6883 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(3..458) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 600..616 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 1124..2302 /label=EF-1-alpha promoter /note="strong constitutive promoter for human elongation factor EF-1-alpha" 5'UTR 2308..2376 /label=derived from human TLR7 /note="derived from human TLR7" CDS 2410..3912 /codon_start=1 /label=SEAP /note="secreted alkaline phosphatase from human placenta" /translation="ILILFNIILISKLLGARWFPVEEENPDFWNREAAEALGAAKKLQP AQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDK HVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVV TTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRK YMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTH LMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESR AYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKA RDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFA RGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTD" polyA_signal complement(3970..4091) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" promoter complement(4256..4274) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(4295..4311) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4319..4335) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4343..4373) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4388..4409) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4697..5285) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5677..6333) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(6334..6436) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" promoter complement(6756..6860) /label=AmpR promoter
This page is informational only.