Basic Vector Information
- Vector Name:
- pTKIP-hygro
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4491 bp
- Type:
- Donor vector
- Replication origin:
- ori
- Source/Author:
- Kuhlman TE, Cox EC.
- Promoter:
- mPGK
pTKIP-hygro vector Map
pTKIP-hygro vector Sequence
LOCUS 40924_43548 4491 bp DNA circular SYN 18-DEC-2018 DEFINITION Donor vector pTKIP-hygro, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4491) AUTHORS Kuhlman TE, Cox EC. TITLE Site-specific chromosomal integration of large synthetic constructs JOURNAL Nucleic Acids Res. 38 (6), E92 (2010) PUBMED 20047970 REFERENCE 2 (bases 1 to 4491) AUTHORS Kuhlman TE, Cox EC. TITLE Direct Submission JOURNAL Submitted (17-DEC-2009) Molecular Biology, Princeton University, Washington Rd., Princeton, NJ 08544, USA REFERENCE 3 (bases 1 to 4491) TITLE Direct Submission REFERENCE 4 (bases 1 to 4491) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res."; date: "2010"; volume: "38"; issue: "6"; pages: "E92" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-DEC-2009) Molecular Biology, Princeton University, Washington Rd., Princeton, NJ 08544, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4491 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 238..426 /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" misc_feature 531..671 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(857..1445) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1619..2476) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(2477..2581) /label=AmpR promoter misc_feature 2607..2624 /label=I-SceI recognition site /note="I-SceI recognition site" misc_feature 2625..2649 /label=Landing Pad Region 1 /note="Landing Pad Region 1" primer_bind 2668..2684 /label=KS primer /note="common sequencing primer, one of multiple similar variants" protein_bind 2706..2739 /label=FRT (minimal) /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" promoter 2803..3302 /label=PGK promoter /note="mouse phosphoglycerate kinase 1 promoter" promoter 3314..3361 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 3380..4378 /codon_start=1 /label=HygR /note="aminoglycoside phosphotransferase from E. coli" /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRP" misc_feature 4415..4448 /label=FRT /note="FRT" protein_bind 4415..4448 /label=FRT (minimal) /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" misc_feature 4449..4473 /label=Landing Pad Region 2 /note="Landing Pad Region 2" misc_feature 4474..4491 /label=I-SceI recognition site /note="I-SceI recognition site"
This page is informational only.