Basic Vector Information
- Vector Name:
- pTip-CH2
- Antibiotic Resistance:
- Tetracycline
- Length:
- 8160 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Nakashima N, Tamura T.
pTip-CH2 vector Map
pTip-CH2 vector Sequence
LOCUS V002644 8160 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002644 VERSION V002644 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8160) AUTHORS Nakashima N, Tamura T. TITLE A novel system for expressing recombinant proteins over a wide temperature range from 4 to 35 degrees C JOURNAL Biotechnol. Bioeng. 86 (2), 136-148 (2004) PUBMED 15052633 REFERENCE 2 (bases 1 to 8160) AUTHORS Nakashima N, Tamura T. TITLE Direct Submission JOURNAL Submitted (17-OCT-2002) Nobutaka Nakashima, National Institute of Advanced Industrial Science and Technology; Tsukisamu-Higashi 2-17-2-1, Sapporo, Toyohira-ku 062-8517, Japan (E-mail:n-nakashima@aist.go.jp, Tel:81-11-857-8937) REFERENCE 3 (bases 1 to 8160) TITLE Direct Submission REFERENCE 4 (bases 1 to 8160) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng."; date: "2004"; volume: "86"; issue: "2"; pages: "136-148" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-OCT-2002) Nobutaka Nakashima, National Institute of Advanced Industrial Science and Technology"; volume: " Tsukisamu-Higashi 2-17-2-1, Sapporo, Toyohira-ku 062-8517, Japan (E-mail:n-nakashima@aist.go.jp, Tel"; pages: "81-11-857-8937" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8160 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 170..976 /gene="tsnR" /label="23S rRNA (adenosine(1067)-2'-O)-methyltransferase" /note="23S rRNA (adenosine(1067)-2'-O)-methyltransferase from Streptomyces azureus. Accession#: P18644" regulatory 1145..1324 /gene="Tuf1" /regulatory_class="promoter" gene 1145..1324 /gene="Tuf1" /label="Tuf1" CDS 1325..2512 /label="TcR" /note="tetracycline efflux protein" regulatory 2728..2903 /gene="ThcA" /regulatory_class="promoter" gene 2728..2903 /gene="ThcA" /label="ThcA" CDS 2904..3662 /gene="tipA" /label="HTH-type transcriptional activator TipA" /note="HTH-type transcriptional activator TipA from Streptomyces lividans. Accession#: P0A4T9" promoter 3843..3947 /label="AmpR promoter" CDS 3948..4805 /label="AmpR" /note="beta-lactamase" rep_origin 4979..5567 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" regulatory complement(5818..5998) /gene="ThcA" /regulatory_class="terminator" gene complement(5818..5998) /gene="ThcA" /label="ThcA" CDS complement(6012..6029) /label="6xHis" /note="6xHis affinity tag" gene complement(6078..6220) /gene="TipA" /label="TipA" regulatory complement(6078..6096) /gene="TipA" /regulatory_class="ribosome_binding_site" regulatory complement(6097..6220) /gene="TipA" /regulatory_class="promoter" CDS 6759..7646 /codon_start=1 /gene="RepA" /label="RepA" /protein_id="BAD11230.1" /translation="MKSATGGVLSDRQWADAVLLPHRPFATNNLQRGQYRMSRDDALAM RYVEHSPHALLGSIVIDCDHVDAAMRAFEQPSDHPAPNWVAQSPSGRAHIGWWLGPNHV CRTDSARLTPLRYAHRIETGLKISVGGDFAYGGQLTKNPIHPDWETIYGPATPYTLRQL ATIHTPRQMPRRPDRAVGLGRNVTMFDATRRWAYPQWWQHRNGTGRDWDHLVLQHCHAV NTEFTTPLPFTEVRATAQSISKWIWRNFTEEQYRARQAHLGQKGGKATTLAKQEAVRNN ARKYDEHTMREAII" gene 6759..7646 /gene="RepA" /label="RepA" CDS 7646..7930 /codon_start=1 /gene="RepB" /label="RepB" /protein_id="BAD11231.1" /translation="MGGAKNPVRRKMTAAAAAEKFGASTRTIQRLFAEPRDDYLGRAKA RRDKAVELRKQGLKYREIAEAMELSTGIVGRLLHDARRHGEISAEDLSA" gene 7646..7930 /gene="RepB" /label="RepB"
This page is informational only.