Basic Vector Information
- Vector Name:
- pTHSSe_67
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6090 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Segall-Shapiro TH, Sontag ED, Voigt CA.
pTHSSe_67 vector Map
pTHSSe_67 vector Sequence
LOCUS 40924_43328 6090 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTHSSe_67, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6090) AUTHORS Segall-Shapiro TH, Sontag ED, Voigt CA. TITLE Engineered promoters enable constant gene expression at any copy number in bacteria JOURNAL Nat. Biotechnol. (2018) In press PUBMED 29553576 REFERENCE 2 (bases 1 to 6090) AUTHORS Segall-Shapiro TH, Sontag ED, Voigt CA. TITLE Direct Submission JOURNAL Submitted (06-MAR-2018) Synthetic Biology Center, Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 6090) TITLE Direct Submission REFERENCE 4 (bases 1 to 6090) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Biotechnol. (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-MAR-2018) Synthetic Biology Center, Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6090 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 13..73 /label=L3S2P21 /note="L3S2P21" /regulatory_class="terminator" regulatory 78..146 /label=PT7A1w3 /note="PT7A1w3" /regulatory_class="promoter" ncRNA 147..225 /product="SarJ" /label=ribozyme /note="insulator" /ncRNA_class="ribozyme" regulatory 226..245 /label=RBSsp2 /note="RBSsp2" /regulatory_class="ribosome_binding_site" CDS 246..2885 /codon_start=1 /product="TALEsp2" /label=TALEsp2 /protein_id="AVR55190.1" /translation="MVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVAL SQHPAALGTVAVKYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQL DTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPDQVVAIASHDGGKQALETVQRLL PVLCQDHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQ ALETVQRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPDQVVA IASNGGGKQALETVQRLLPVLCQDHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAH GLTPDQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPAQVVAIASNNGGKQALETVQR LLPVLCQDHGLTPDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPEQVVAIASHDGG KQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPAQV VAIASHDGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNIGGKQALETVQRLLPVLCQ DHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETV QRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPEQVVAIASNG GGRPALESIVAQLSRPDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNR RIPERTSHRVADHAQVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTEL EARSGTLPPASQRWDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMH EGDQTRAS" regulatory complement(2891..2980) /label=ECK120029600 /note="ECK120029600" /regulatory_class="terminator" regulatory 2985..3059 /label=PUPsp2 /note="PUPsp2" /regulatory_class="promoter" misc_feature 3010..3016 /label=bfpT7A1 /note="bfpT7A1" protein_bind complement(3018..3035) /label=TALEsp2 binding site /bound_moiety="TALEsp2" misc_RNA 3061..3111 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" regulatory 3135..3153 /label=RBSB03 /note="RBSB03" /regulatory_class="ribosome_binding_site" misc_feature 3135..3137 /label=E0240 /note="E0240" CDS 3154..3867 /label=superfolder GFP /note="GFP variant that folds robustly even when fused to poorly folded proteins (Nager et al., 2011)" terminator 3887..3958 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 3974..4001 /label=T7Te terminator /note="phage T7 early transcription terminator" misc_feature 4020..4040 /label=BioBrick suffix /note="universal suffix for all parts" terminator 4041..4098 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." rep_origin 4270..4858 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(5065..5159) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(5183..5839) /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(5840..5943) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" terminator complement(6023..6066) /label=bacterial terminator /note="putative bacterial transcription terminator" misc_feature 6069..6090 /label=BioBrick prefix /note="BioBrick prefix for parts that do not start with 'ATG'"
This page is informational only.