pTHSSe_41 vector (V002677)

Basic Vector Information

Vector Name:
pTHSSe_41
Antibiotic Resistance:
Streptomycin
Length:
5150 bp
Type:
Cloning vector
Replication origin:
p15A ori
Source/Author:
Segall-Shapiro TH, Sontag ED, Voigt CA.
Promoter:
tac

pTHSSe_41 vector Vector Map

pTHSSe_415150 bp6001200180024003000360042004800tac promoterlac operator (symmetric)sTRSV HHRzRBS32A; derived from BBa_B0032RepArrnB T1 terminatorT7Te terminatorBioBrick suffixhis operon terminatorSmRp15A oribacterial terminatorlacILacI promoter

pTHSSe_41 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_43278        5150 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pTHSSe_41, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5150)
  AUTHORS   Segall-Shapiro TH, Sontag ED, Voigt CA.
  TITLE     Engineered promoters enable constant gene expression at any copy 
            number in bacteria
  JOURNAL   Nat. Biotechnol. (2018) In press
  PUBMED    29553576
REFERENCE   2  (bases 1 to 5150)
  AUTHORS   Segall-Shapiro TH, Sontag ED, Voigt CA.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAR-2018) Synthetic Biology Center, Department of 
            Biological Engineering, Massachusetts Institute of Technology, 77 
            Massachusetts Avenue, Cambridge, MA 02139, USA
REFERENCE   3  (bases 1 to 5150)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5150)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat. 
            Biotechnol. (2018) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (06-MAR-2018) Synthetic Biology Center, Department of Biological 
            Engineering, Massachusetts Institute of Technology, 77 Massachusetts
            Avenue, Cambridge, MA 02139, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5150
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        3..31
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    complement(37..56)
                     /label=lac operator (symmetric)
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG). The 
                     symmetric lac operator was optimized for tight binding of 
                     lac repressor."
     misc_RNA        73..123
                     /label=sTRSV HHRz
                     /note="hammerhead ribozyme from the tobacco ringspot virus 
                     satellite RNA (Khvorova et al., 2003)"
     regulatory      147..165
                     /note="RBS32A; derived from BBa_B0032"
                     /regulatory_class="ribosome_binding_site"
     CDS             166..1059
                     /codon_start=1
                     /product="RepA"
                     /label=RepA
                     /note="ColE2 replication protein"
                     /protein_id="AVR55117.1"
                     /translation="MSAVLQRFREKLPHKPYCTNDFAYGVRILPKNIAILARFIQQNQP
                     HALYWLPFDVDRTGASIDWSDRNCPAPNITVKNPRNGHAHLLYALALPVRTAPDASASA
                     LRYAAAIERALCEKLGADVNYSGLICKNPCHPEWQEVEWREEPYTLDELADYLDLSASA
                     RRSVDKNYGLGRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVPLSP
                     AECRAIGKSIAKYTHRKFSPEGFSAVQAARGRKGGTKSKRAAVPTSARSLKPWEALGIS
                     RATYYRKLKCDPDLAK"
     terminator      1073..1144
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      1160..1187
                     /label=T7Te terminator
                     /note="phage T7 early transcription terminator"
     misc_feature    1194..1214
                     /label=BioBrick suffix
                     /note="universal suffix for all parts"
     terminator      1215..1272
                     /label=his operon terminator
                     /note="This putative transcriptin terminator from the E.
                     coli his operon has a 2-bp deletion introduced during 
                     synthesis. Its efficiency has not been determined."
     CDS             complement(1433..2221)
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     rep_origin      complement(2816..3360)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     terminator      complement(3850..3893)
                     /label=bacterial terminator
                     /note="putative bacterial transcription terminator"
     CDS             complement(3939..5018)
                     /label=lacI
                     /note="lac repressor"
     regulatory      complement(5019..5100)
                     /label=LacI promoter
                     /note="LacI promoter"
                     /regulatory_class="promoter"

This page is informational only.