Basic Vector Information
- Vector Name:
- pTHSSe_39
- Antibiotic Resistance:
- Streptomycin
- Length:
- 6896 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Segall-Shapiro TH, Sontag ED, Voigt CA.
- Promoter:
- tac
pTHSSe_39 vector Vector Map
pTHSSe_39 vector Sequence
LOCUS 40924_43268 6896 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTHSSe_39, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6896) AUTHORS Segall-Shapiro TH, Sontag ED, Voigt CA. TITLE Engineered promoters enable constant gene expression at any copy number in bacteria JOURNAL Nat. Biotechnol. (2018) In press PUBMED 29553576 REFERENCE 2 (bases 1 to 6896) AUTHORS Segall-Shapiro TH, Sontag ED, Voigt CA. TITLE Direct Submission JOURNAL Submitted (06-MAR-2018) Synthetic Biology Center, Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 6896) TITLE Direct Submission REFERENCE 4 (bases 1 to 6896) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Biotechnol. (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-MAR-2018) Synthetic Biology Center, Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6896 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 3..31 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind complement(37..56) /label=lac operator (symmetric) /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." misc_RNA 73..123 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" regulatory 147..165 /note="RBS32A; derived from BBa_B0032" /regulatory_class="ribosome_binding_site" CDS 166..2805 /codon_start=1 /product="TALEsp1" /label=TALEsp1 /protein_id="AVR55111.1" /translation="MVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVAL SQHPAALGTVAVKYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQL DTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPDQVVAIASNGGGKQALETVQRLL PVLCQDHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQ ALETVQRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPDQVVA IASNIGGKQALETVQRLLPVLCQDHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAH GLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALETVQR LLPVLCQDHGLTPDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPEQVVAIASNIGG KQALETVQRLLPVLCQAHGLTPDQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPAQV VAIASHDGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQ DHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETV QRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPEQVVAIASNN GGRPALESIVAQLSRPDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNR RIPERTSHRVADHAQVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTEL EARSGTLPPASQRWDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMH EGDQTRAS" terminator 2819..2890 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2906..2933 /label=T7Te terminator /note="phage T7 early transcription terminator" misc_feature 2940..2960 /label=BioBrick suffix /note="universal suffix for all parts" terminator 2961..3018 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." CDS complement(3179..3967) /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" rep_origin complement(4562..5106) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." terminator complement(5596..5639) /label=bacterial terminator /note="putative bacterial transcription terminator" CDS complement(5685..6764) /label=lacI /note="lac repressor" regulatory complement(6765..6846) /label=LacI promoter /note="LacI promoter" /regulatory_class="promoter"
This page is informational only.