Basic Vector Information
- Vector Name:
- pTHSSe_38
- Antibiotic Resistance:
- Streptomycin
- Length:
- 6488 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Segall-Shapiro TH, Sontag ED, Voigt CA.
- Promoter:
- tac
pTHSSe_38 vector Map
pTHSSe_38 vector Sequence
LOCUS 40924_43263 6488 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pTHSSe_38, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6488)
AUTHORS Segall-Shapiro TH, Sontag ED, Voigt CA.
TITLE Engineered promoters enable constant gene expression at any copy
number in bacteria
JOURNAL Nat. Biotechnol. (2018) In press
PUBMED 29553576
REFERENCE 2 (bases 1 to 6488)
AUTHORS Segall-Shapiro TH, Sontag ED, Voigt CA.
TITLE Direct Submission
JOURNAL Submitted (06-MAR-2018) Synthetic Biology Center, Department of
Biological Engineering, Massachusetts Institute of Technology, 77
Massachusetts Avenue, Cambridge, MA 02139, USA
REFERENCE 3 (bases 1 to 6488)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6488)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat.
Biotechnol. (2018) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(06-MAR-2018) Synthetic Biology Center, Department of Biological
Engineering, Massachusetts Institute of Technology, 77 Massachusetts
Avenue, Cambridge, MA 02139, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6488
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 3..31
/label=tac promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
protein_bind complement(37..56)
/label=lac operator (symmetric)
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
misc_RNA 73..123
/label=sTRSV HHRz
/note="hammerhead ribozyme from the tobacco ringspot virus
satellite RNA (Khvorova et al., 2003)"
regulatory 147..165
/note="RBS32A; derived from BBa_B0032"
/regulatory_class="ribosome_binding_site"
CDS 166..2397
/codon_start=1
/product="TALE1"
/label=TALE1
/protein_id="AVR55108.1"
/translation="MVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVAL
SQHPAALGTVAVKYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQL
DTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPEQVVAIASNIGGKQALETVQRLL
PVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQ
ALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPEQVVA
IASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAH
GLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQR
LLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGG
KQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPEQV
VAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGRPALESIVAQLSRPDP
ALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHAQVVR
VLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPASQRWDRIL
QASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHEGDQTRAS"
terminator 2411..2482
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 2498..2525
/label=T7Te terminator
/note="phage T7 early transcription terminator"
misc_feature 2532..2552
/label=BioBrick suffix
/note="universal suffix for all parts"
terminator 2553..2610
/label=his operon terminator
/note="This putative transcriptin terminator from the E.
coli his operon has a 2-bp deletion introduced during
synthesis. Its efficiency has not been determined."
CDS complement(2771..3559)
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
rep_origin complement(4154..4698)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
terminator complement(5188..5231)
/label=bacterial terminator
/note="putative bacterial transcription terminator"
CDS complement(5277..6356)
/label=lacI
/note="lac repressor"
regulatory complement(6357..6438)
/label=LacI promoter
/note="LacI promoter"
/regulatory_class="promoter"
This page is informational only.