Basic Vector Information
- Vector Name:
- pTH18cs5
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3064 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Hashimoto-Gotoh T, Yamaguchi M, Yasojima K, Tsujimura A, Wakabayashi Y, Watanabe Y.
pTH18cs5 vector Map
pTH18cs5 vector Sequence
LOCUS 40924_43218 3064 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTH18cs5 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3064) AUTHORS Hashimoto-Gotoh T, Yamaguchi M, Yasojima K, Tsujimura A, Wakabayashi Y, Watanabe Y. TITLE A set of temperature sensitive-replication/-segregation and temperature resistant plasmid vectors with different copy numbers and in an isogenic background (chloramphenicol, kanamycin, lacZ, repA, par, polA) JOURNAL Gene 241 (1), 185-191 (2000) PUBMED 10607913 REFERENCE 2 (bases 1 to 3064) AUTHORS Hashimoto-Gotoh T. TITLE Direct Submission JOURNAL Submitted (10-NOV-1998) Contact:Tamotsu Hashimoto-Gotoh Res. Inst. for Geriatrics, Kyoto Pref. Univ. Med., Biochem. and Mol. Genet.; Kawaramachi-Hirokoji, Kajii-Cho 465, Kamigyo-ku, Kyoto, Kyoto 602-8566, Japan REFERENCE 3 (bases 1 to 3064) TITLE Direct Submission REFERENCE 4 (bases 1 to 3064) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "2000"; volume: "241"; issue: "1"; pages: "185-191" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-NOV-1998) Contact:Tamotsu Hashimoto-Gotoh Res. Inst. for Geriatrics, Kyoto Pref. Univ. Med., Biochem. and Mol. Genet.; Kawaramachi-Hirokoji, Kajii-Cho 465, Kamigyo-ku, Kyoto, Kyoto 602-8566, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT On Jun 23, 1999 this sequence version replaced AB019611.1. The copy number of pKF38ts5 is 1 per chromosome. Drug concentration for chloramphenicol selection should be 8 to 10 microgramms per ml. TOP10 but neither DH5alpha nor JM109 is advisable as a host strain for alpha-complemetation selection . The multiple cloning sites are as in pKF18c (Gene, 1994; 152, 271-275). FEATURES Location/Qualifiers source 1..3064 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 18..74 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(75..91) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(537..1193) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(1194..1296) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin 1637..1859 /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" CDS 1907..2854 /codon_start=1 /label=Rep101 /note="RepA protein needed for replication with the pSC101 origin" /translation="MSELVVFKANELTISRYDLTEHETKLILCCVALLNPTIENPTRKE RTVSFTYNQYAQMMNISRENAYGVLAKATRELMTRTVEIRNPLVKGFEIFQWTNYAKFS SEKLELVFSEEILPYLFQLKKFIKYNLEHVKSFENKYSMRIYEWLLKELTQKKTHKANI EISLDEFKFMLMLENNYHEFKRLNQWVLKPISKDLNTYSNMKLVVDKRGRPTDTLIFQV ELDRQMDLVTELENNQIKMNGDKIPTTITSDSYLHNGLRKTLHDALTAKIQLTSFEAKF LSDMQSKYDLNGSFSWLTQKQRTTLENILAKYGRI" protein_bind 2956..2977 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2992..3022 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3030..3046 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.