Basic Vector Information
- Vector Name:
- pTH18cs1
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3064 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Hashimoto-Gotoh T, Yamaguchi M, Yasojima K, Tsujimura A, Wakabayashi Y, Watanabe Y.
pTH18cs1 vector Vector Map
pTH18cs1 vector Sequence
LOCUS 40924_43213 3064 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTH18cs1 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3064) AUTHORS Hashimoto-Gotoh T, Yamaguchi M, Yasojima K, Tsujimura A, Wakabayashi Y, Watanabe Y. TITLE A set of temperature sensitive-replication/-segregation and temperature resistant plasmid vectors with different copy numbers and in an isogenic background (chloramphenicol, kanamycin, lacZ, repA, par, polA) JOURNAL Gene 241 (1), 185-191 (2000) PUBMED 10607913 REFERENCE 2 (bases 1 to 3064) AUTHORS Hashimoto-Gotoh T. TITLE Direct Submission JOURNAL Submitted (10-NOV-1998) Contact:Tamotsu Hashimoto-Gotoh Res. Inst. for Geriatrics, Kyoto Pref. Univ. Med., Biochem. and Mol. Genet.; Kawaramachi-Hirokoji, Kajii-Cho 465, Kamigyo-ku, Kyoto, Kyoto 602-8566, Japan REFERENCE 3 (bases 1 to 3064) TITLE Direct Submission REFERENCE 4 (bases 1 to 3064) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "2000"; volume: "241"; issue: "1"; pages: "185-191" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-NOV-1998) Contact:Tamotsu Hashimoto-Gotoh Res. Inst. for Geriatrics, Kyoto Pref. Univ. Med., Biochem. and Mol. Genet.; Kawaramachi-Hirokoji, Kajii-Cho 465, Kamigyo-ku, Kyoto, Kyoto 602-8566, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT On Jun 23, 1999 this sequence version replaced AB019610.1. The copy number of pKF38ts1 is 14 per chromosome. Drug concentration for chloramphenicol selection should be 10 to 15 microgramms per ml. TOP10 but neither DH5alpha nor JM109 is advisable as a host strain for alpha-complemetation selection . The multiple cloning sites are as in pKF18c (Gene, 1994; 152, 271-275). FEATURES Location/Qualifiers source 1..3064 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 18..74 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(75..91) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(537..1193) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(1194..1296) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin 1637..1859 /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" CDS 1907..2854 /codon_start=1 /label=Rep101(Ts) /note="temperature-sensitive version of the RepA protein needed for replication with the pSC101 origin (Armstrong et al., 1984)" /translation="MSELVVFKANELAISRYDLTEHETKLILCCVALLNPTIENPTRKE RTVSFTYNQYVQMMNISRENAYGVLAKATRELMTRTVEIRNPLVKGFEIFQWTNYAKFS SEKLELVFSEEILPYLFQLKKFIKYNLEHVKSFENKYSMRIYEWLLKELTQKKTHKANI EISLDEFKFMLMLENNYHEFKRLNQWVLKPISKDLNTYSNMKLVVDKRGRPTDTLIFQV ELDRQMDLVTELENNQIKMNGDKIPTTITSDSYLHNGLRKTLHDALTAKIQLTSFEAKF LSDMQSKYDLNGSFSWLTQKQRTTLENILAKYGRI" protein_bind 2956..2977 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2992..3022 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3030..3046 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.