Basic Vector Information
- Vector Name:
- pTEX5500ts
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5646 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Nallapareddy SR, Singh KV, Murray BE.
pTEX5500ts vector Map
pTEX5500ts vector Sequence
LOCUS V002747 5646 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002747 VERSION V002747 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5646) AUTHORS Nallapareddy SR, Singh KV, Murray BE. TITLE Construction of Improved Temperature-Sensitive and Mobilizable Vectors and Their Use for Constructing Mutations in the Adhesin-Encoding acm Gene of Poorly Transformable Clinical Enterococcus faecium Strains JOURNAL Appl. Environ. Microbiol. 72 (1), 334-345 (2006) PUBMED 16391062 REFERENCE 2 (bases 1 to 5646) AUTHORS Nallapareddy SR, Singh KV, Murray BE. TITLE Direct Submission JOURNAL Submitted (18-SEP-2005) Infectious Diseases, Univ. of Texas Med. School at Houston, 6431 Fannin St, MSB 2.112, Houston, TX 77030, USA REFERENCE 3 (bases 1 to 5646) TITLE Direct Submission REFERENCE 4 (bases 1 to 5646) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2006"; volume: "72"; issue: "1"; pages: "334-345" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-SEP-2005) Infectious Diseases, Univ. of Texas Med. School at Houston, 6431 Fannin St, MSB 2.112, Houston, TX 77030, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5646 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..61 /note="multiple cloning site I; MCS-I" CDS 195..842 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" misc_feature 1007..1076 /note="multiple cloning site II; MCS-II" CDS complement(1479..1490) /label="Factor Xa site" /note="Factor Xa recognition and cleavage site" CDS 1624..1833 /codon_start=1 /gene="orfB" /product="OrfB" /label="orfB" /note="portion of pWV01 based temperature-sensitive gram-positive replicon derived from pTV1-OK" /protein_id="ABB20795.1" /translation="MGGKEANFASVLRPPIKCRVPIFVPKTLYPNWLKGLRGFSIANES PTFSPTFFINLYLSSFIVVFMITK" gene 1624..1833 /gene="orfB" /label="orfB" CDS 1874..2035 /codon_start=1 /gene="orfC" /product="OrfC" /label="orfC" /note="portion of pWV01 based temperature-sensitive gram-positive replicon derived from pTV1-OK" /protein_id="ABB20796.1" /translation="MVISESKKRVMISLTKEQDKKLTDMAKQKGFSKSAVAALAIEEYA RKESEQKK" gene 1874..2035 /gene="orfC" /label="orfC" CDS 2102..2800 /codon_start=1 /gene="repA(ts)" /product="RepA(ts)" /label="repA(ts)" /note="portion of pWV01 based temperature-sensitive gram-positive replicon derived from pTV1-OK" /protein_id="ABB20797.1" /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDLYITLDESQKRELKNLLLDIV DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK VLDAETGEIK" gene 2102..2800 /gene="repA(ts)" /label="repA(ts)" CDS 2797..2946 /codon_start=1 /gene="orfD" /product="OrfD" /label="orfD" /note="portion of pWV01 based temperature-sensitive gram-positive replicon derived from pTV1-OK" /protein_id="ABB20798.1" /translation="MTNKEKELFAENEELKKEIKDLKERIERYREMEVELSTTIDLLRG GIIE" gene 2797..2946 /gene="orfD" /label="orfD" CDS 3173..4078 /codon_start=1 /gene="aph(2')-Id" /product="APH(2')-Id" /label="aph(2')-Id" /note="aminoglycoside modifying enzyme; derived from Enterococcus casseliflavus in GenBank Accession Number AF016483" /protein_id="ABB20799.1" /translation="MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIF KFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLT PLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSR ELKGPQMKIVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAA ISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKE YGYMDWYEEGLNEIRSIKIK" gene 3173..4078 /gene="aph(2')-Id" /label="aph(2')-Id" rep_origin complement(4403..4991) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.