Basic Vector Information
- Vector Name:
- pTcPTPN-CO 1.1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7373 bp
- Type:
- Protein fusion vector
- Replication origin:
- ori
- Source/Author:
- Kugeratski FG, Batista M, Inoue AH, Ramos BD, Krieger MA, Marchini/ FK.
pTcPTPN-CO 1.1 vector Map
pTcPTPN-CO 1.1 vector Sequence
LOCUS 40924_42809 7373 bp DNA circular SYN 18-DEC-2018 DEFINITION Protein fusion vector pTcPTPN-CO 1.1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7373) AUTHORS Kugeratski FG, Batista M, Inoue AH, Ramos BD, Krieger MA, Marchini/ FK. TITLE pTcGW plasmid vectors 1.1 version: a versatile tool for Trypanosoma cruzi gene characterisation JOURNAL Mem. Inst. Oswaldo Cruz (2015) In press PUBMED 26200713 REFERENCE 2 (bases 1 to 7373) AUTHORS Kugeratski FG, Batista M, Inoue AH, Ramos BD, Krieger MA, Marchini FK. TITLE Direct Submission JOURNAL Submitted (22-APR-2015) Mass Spectrometry Platform, Instituto Carlos Chagas, Professor Algacyr Munhoz Mader, 3775, Curitiba, Parana 81350010, Brasil REFERENCE 3 (bases 1 to 7373) TITLE Direct Submission REFERENCE 4 (bases 1 to 7373) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mem. Inst. Oswaldo Cruz (2015) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-APR-2015) Mass Spectrometry Platform, Instituto Carlos Chagas, Professor Algacyr Munhoz Mader, 3775, Curitiba, Parana 81350010, Brasil" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7373 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(3..458) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 600..616 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" regulatory 659..1275 /note="derived from Trypanosoma cruzi 18S ribosomal RNA gene promoter region" /regulatory_class="promoter" protein_bind 1569..1688 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 1718..1748 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 1802..2458 /label=CmR /note="chloramphenicol acetyltransferase" CDS 2803..3105 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" protein_bind complement(3149..3273) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 3344..3364 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" CDS 3404..3577 /label=ProtA /note="IgG-binding unit of Staphylococcus aureus protein A" CDS 3581..3751 /codon_start=1 /product="IgG-binding unit of Staphylococcus aureus protein A" /label=ProtA /translation="DNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLA EAKKLNGAQAPK" CDS 4085..4873 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" promoter complement(5185..5203) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(5224..5240) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(5248..5264) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5272..5302) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(5317..5338) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5626..6214) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6388..7245) /label=AmpR /note="beta-lactamase" promoter complement(7246..7350) /label=AmpR promoter
This page is informational only.