Basic Vector Information
- Vector Name:
- pTBR101-CM
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8365 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Hirayama Y, Sakanaka M, Fukuma H, Murayama H, Kano Y, Fukiya S, Yokota A.
pTBR101-CM vector Map
pTBR101-CM vector Sequence
LOCUS V002806 8365 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002806 VERSION V002806 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8365) AUTHORS Hirayama Y, Sakanaka M, Fukuma H, Murayama H, Kano Y, Fukiya S, Yokota A. TITLE Development of a Double-Crossover Markerless Gene Deletion System in Bifidobacterium longum: Functional Analysis of the alpha-Galactosidase Gene for Raffinose Assimilation JOURNAL Appl. Environ. Microbiol. 78 (14), 4984-4994 (2012) PUBMED 22582061 REFERENCE 2 (bases 1 to 8365) AUTHORS Hirayama Y, Sakanaka M, Fukuma H, Murayama H, Kano Y, Fukiya S, Yokota A. TITLE Direct Submission JOURNAL Submitted (11-DEC-2011) Contact:Satoru Fukiya Hokkaido University, Laboratory of Microbial Physiology, Research Faculty of Agriculture; Kita 9, Nishi 9, Kita-ku, Sapporo, Hokkaido 060-8589, Japan REFERENCE 3 (bases 1 to 8365) TITLE Direct Submission REFERENCE 4 (bases 1 to 8365) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2012"; volume: "78"; issue: "14"; pages: "4984-4994" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-DEC-2011) Contact:Satoru Fukiya Hokkaido University, Laboratory of Microbial Physiology, Research Faculty of Agriculture; Kita 9, Nishi 9, Kita-ku, Sapporo, Hokkaido 060-8589, Japan" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8365 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(109..756) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" misc_feature 1046..1393 /label="derived from Escherichia coli plasmid pBR322" /note="derived from Escherichia coli plasmid pBR322" misc_feature 1104..1393 /gene="tetA" /note="tetA was disrupted by the insertion of Bifidobacterium longum BK25 plasmid pTB4" gene 1104..1393 /gene="tetA" /label="tetA" misc_feature 1394..4351 /note="derived from Bifidobacterium longum BK25 plasmid pTB4" CDS complement(1689..2249) /codon_start=1 /gene="pTB4_p1" /product="hypothetical protein" /label="pTB4_p1" /protein_id="BAL42613.1" /translation="MTNQLLTPAQCPAHRRRIRDAVPGRVQAGHRAQRLGAGTGVRAPL PLLCGRALPAHGREHPRQRDDAAQGAQGEGRWKMTFQKKEEPLPVRGRRHHPERSSTLM RFPMRSDGYIHGHPHGHPHGHLHGHLHGHLHGHLHGHLHGHPHGDVHQIEGKQARRFMY MNRARSLPRPSAQEQQPECRRPE" gene complement(1689..2249) /gene="pTB4_p1" /label="pTB4_p1" CDS 2402..3325 /codon_start=1 /gene="repA" /product="plasmid replication initiation protein RepA" /label="repA" /protein_id="BAL42614.1" /translation="MSNEYVQGTLELTRAFDGWWLPQRPLCCDDDYSQLVRRSRIDALR CKHIEANPAAQVNMLVVDVDSSEGRLMSLWGHRDMPPNFIAENPANGHCHAGWVLTEPV CRTDMARLKPLKLLHAVTEGLRRSVDGDEGYSGLLMKNPLSDAWDSDLCREDTYDLPDL VAALEAHGDMPPKSWTRTKRAREVGVGRNCTLFDEARTLAYREVRRLPDRTPASSDLLR EYVRRTCHEINASFPDPLPVREVNDTAKSIHKWITTRSRMWRDGAVANAATFVAIQSAR GKKSGEARQNAFEEKFAQYAQEVLGQ" gene 2402..3325 /gene="repA" /label="repA" CDS 3322..3612 /codon_start=1 /gene="repB" /product="plasmid replication initiation protein RepB" /label="repB" /protein_id="BAL42615.1" /translation="MTIQTIRKKRPLPAKELAEAYGVSVRTIKYWNSQTREDWIDEQAT LRESIRAYHDDDGHSWSQTAEHFNMTQGAVRQRAYRARKEREAEAKAARPE" gene 3322..3612 /gene="repB" /label="repB" CDS complement(3813..4094) /codon_start=1 /gene="pTB4_p2" /product="hypothetical protein" /label="pTB4_p2" /note="Similar to Blon_0217 (Ribbon-helix-helix protein, copG family) [Bifidobacterium longum subsp. infantis ATCC 15697]" /protein_id="BAL42616.1" /translation="MSDFSERDRQLMALVGLTEEQVLEDERMAESETVPDDLTGRVYYG LHLAEPDEQMVSVSVRMPKSTLDGLTAMARRYHISRSEYMRRKLAGAI" gene complement(3813..4094) /gene="pTB4_p2" /label="pTB4_p2" CDS complement(4091..4333) /codon_start=1 /gene="pTB4_p3" /product="hypothetical protein" /label="pTB4_p3" /protein_id="BAL42617.1" /translation="MERHPELSEKDVVTAFRSVMVDAERESGAWMAIGLDGRGRNVEML YRVVGDLVVIYHAFTPPTKKFRREIDRLRGDGRTL" gene complement(4091..4333) /gene="pTB4_p3" /label="pTB4_p3" misc_feature 4352..5252 /gene="tetA" /note="tetA was disrupted by the insertion of Bifidobacterium longum BK25 plasmid pTB4" gene 4352..5252 /gene="tetA" /label="tetA" CDS 5891..6079 /label="rop" /note="Rop protein, which maintains plasmids at low copy number" misc_feature 6184..6324 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(6510..7098) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7272..8129) /label="AmpR" /note="beta-lactamase" promoter complement(8130..8234) /label="AmpR promoter"
This page is informational only.