Basic Vector Information
- Vector Name:
- pTac-VvSTS-Sc4CLm
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7194 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Kim B, Binkley R, Kim HU, Lee SY.
- Promoter:
- tac
pTac-VvSTS-Sc4CLm vector Map
pTac-VvSTS-Sc4CLm vector Sequence
LOCUS V002823 7194 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002823 VERSION V002823 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7194) AUTHORS Kim B, Binkley R, Kim HU, Lee SY. TITLE Metabolic engineering of Escherichia coli for the enhanced production of l-tyrosine JOURNAL Biotechnol. Bioeng. (2018) In press PUBMED 30019750 REFERENCE 2 (bases 1 to 7194) AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY. TITLE Direct Submission JOURNAL Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea REFERENCE 3 (bases 1 to 7194) TITLE Direct Submission REFERENCE 4 (bases 1 to 7194) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng. (2018) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7194 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 8..1576 /codon_start=1 /gene="Sc4CLm" /product="4-coumarate:CoA ligase mutant" /label="Sc4CLm" /note="A294G; derived from Streptomyces coelicolor" /protein_id="AXN70047.1" /translation="MFRSEYADVPPVDLPIHDAVLGGAAAFGSTPALIDGTDGTTLTYE QVDRFHRRVAAALAETGVRKGDVLALHSPNTVAFPLAFYAATRAGASVTTVHPLATAEE FAKQLKDSAARWIVTVSPLLSTARRAAELAGGVQEILVCDSAPGHRSLVDMLASTAPEP SVAIDPAEDVAALPYSSGTTGTPKGVMLTHRQIATNLAQLEPSMPSAPGDRVLAVLPFF HIYGLTALMNAPLRLGATVVVLPRFDLEQFLAAIQNHRITSLYVAPPIVLALAKHPLVA DYDLSSLRYIVSGAAPLDARLAAACSQRLGLPPVGQAYGMTELSPGTHVVPLDAMADAP PGTVGRLIAGTEMRIVSLTDPGTDLPAGESGEILIRGPQIMKGYLGRPDATAAMIDEEG WLHTGDVGHVDADGWLFVVDRVKELIKYKGFQVAPAELEAHLLTHPGVADAAVVGAYDD DGNEVPHAFVVRQPAAPGLAESEIMMYVAERVAPYKRVRRVTFVDAVPRAASGKILRRQ LREPR" gene 8..1576 /gene="Sc4CLm" /label="Sc4CLm" terminator 1825..1911 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2003..2030 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2050..2141 /label="AmpR promoter" primer_bind complement(2454..2470) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS 2713..3525 /label="KanR" /note="aminoglycoside phosphotransferase" rep_origin 4057..4602 /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 5037..5065 /label="tac promoter" /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 5073..5089 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 5111..6286 /note="Stilbene synthase 2 from Vitis vinifera. Accession#: P51070" /label="Stilbene synthase 2" terminator complement(6541..6584) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 6716..6743 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" regulatory 7128..7156 /label="Tac promoter" /note="Tac promoter" /regulatory_class="promoter" promoter 7128..7156 /label="tac promoter" /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 7164..7180 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.