Basic Vector Information
- Vector Name:
- pTac-Sc4CL
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5305 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Kim B, Binkley R, Kim HU, Lee SY.
- Promoter:
- tac
pTac-Sc4CL vector Vector Map
pTac-Sc4CL vector Sequence
LOCUS 40924_42469 5305 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTac-Sc4CL, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5305) AUTHORS Kim B, Binkley R, Kim HU, Lee SY. TITLE Metabolic engineering of Escherichia coli for the enhanced production of l-tyrosine JOURNAL Biotechnol. Bioeng. (2018) In press PUBMED 30019750 REFERENCE 2 (bases 1 to 5305) AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY. TITLE Direct Submission JOURNAL Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea REFERENCE 3 (bases 1 to 5305) TITLE Direct Submission REFERENCE 4 (bases 1 to 5305) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng. (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5305 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 8..1576 /codon_start=1 /gene="Sc4CL" /product="4-coumarate:CoA ligase" /label=Sc4CL /note="derived from Streptomyces coelicolor" /protein_id="AXN70032.1" /translation="MFRSEYADVPPVDLPIHDAVLGGAAAFGSTPALIDGTDGTTLTYE QVDRFHRRVAAALAETGVRKGDVLALHSPNTVAFPLAFYAATRAGASVTTVHPLATAEE FAKQLKDSAARWIVTVSPLLSTARRAAELAGGVQEILVCDSAPGHRSLVDMLASTAPEP SVAIDPAEDVAALPYSSGTTGTPKGVMLTHRQIATNLAQLEPSMPSAPGDRVLAVLPFF HIYGLTALMNAPLRLGATVVVLPRFDLEQFLAAIQNHRITSLYVAPPIVLALAKHPLVA DYDLSSLRYIVSAAAPLDARLAAACSQRLGLPPVGQAYGMTELSPGTHVVPLDAMADAP PGTVGRLIAGTEMRIVSLTDPGTDLPAGESGEILIRGPQIMKGYLGRPDATAAMIDEEG WLHTGDVGHVDADGWLFVVDRVKELIKYKGFQVAPAELEAHLLTHPGVADAAVVGAYDD DGNEVPHAFVVRQPAAPGLAESEIMMYVAERVAPYKRVRRVTFVDAVPRAASGKILRRQ LREPR" gene 8..1576 /gene="Sc4CL" /label=Sc4CL terminator 1825..1911 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2003..2030 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2050..2141 /label=AmpR promoter primer_bind complement(2454..2470) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 2713..3525 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 4057..4602 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 5239..5267 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 5275..5291 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.